Immunohistochemistry (IHC) : Human thyroid gland stained with anti-PAX-8 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear stain of follicular cells.

rabbit anti-PAX-8 monoclonal antibody (ZR1) 6323

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PAX-8
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:Rabbit IgG
Control: Ovarian serous carcinoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6323parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, PAX-8, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	Rabbit IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PAX-8 monoclonal antibody ZR1 6323

antibody
Database link: human Q06710
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Ovarian serous carcinoma
Immunogen Synthetic peptide corresponding to the C-terminus of Human PAX8 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens PAX8 Paired box protein Pax-8
Protein names Paired box protein Pax-8
Gene names PAX8
Function Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells
Subcellular location Nucleus
Structure Interacts with WWTR1
Involvement in disease Hypothyroidism, congenital, non-goitrous, 2 A disease characterized by thyroid dysgenesis, the most frequent cause of congenital hypothyroidism, accounting for 85% of case. The thyroid gland can be completely absent (athyreosis), ectopically located and/or severely hypoplastic. Ectopic thyroid gland is the most frequent malformation, with thyroid tissue being found most often at the base of the tongue.
Keywords 3D-structure, Alternative splicing, Congenital hypothyroidism, Developmental protein, Differentiation, Disease variant, DNA-binding, Nucleus, Paired box, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQAL LSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP NSSLLSSPYYYSSTSRPSAPPTTATAFDHL
UniProt accession: Q06710

Data

Human thyroid gland stained with anti-PAX-8 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear stain of follicular cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-PAX-8 monoclonal antibody (ZR1) 6323 react with?

This antibody specifically reacts with human tissues.

What are the recommended storage conditions for the rabbit anti-PAX-8 monoclonal antibody (ZR1) 6323?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, store it at -20°C while avoiding freeze/thaw cycles.

Which application is the rabbit anti-PAX-8 monoclonal antibody (ZR1) 6323 validated for?

This antibody is validated for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.