Immunohistochemistry (IHC) : Human prostatic tissue stained with anti-Prostein antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of benign prostate glands.

rabbit anti-Prostein (P501S) monoclonal antibody (ZR9) 6347

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Prostein (P501S)
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Normal prostate or prostate carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6347parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, Prostein (P501S), Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Prostein (P501S) monoclonal antibody ZR9 6347

antibody
Database link: human Q96JT2
Tested applications IHC
Recommended dilutions Concentrated 1:200
Application Notes Positive control: Normal prostate or prostate carcinoma
Immunogen Synthesized peptides to the N-terminus of human protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens SLC45A3 Solute carrier family 45 member 3
Protein names Solute carrier family 45 member 3
Alternative names Prostate cancer-associated protein 6, Prostein
Gene names SLC45A3
Protein family Belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family
Function Proton-associated sucrose transporter. May be able to transport also glucose and fructose
Catalytic activity sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in)
Subcellular location Membrane
Keywords Membrane, Proteomics identification, Reference proteome, Symport, Transmembrane, Transmembrane helix, Transport
Sequence MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG PVLGLVCVPLLGSASDHWRGRYGRRRPFIWALSLGILLSLFLIPRAGWLAGLLCPDPRPL ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPA IDWDTSALAPYLGTQEECLFGLLTLIFLTCVAATLLVAEEAALGPTEPAEGLSAPSLSPH CCPCRARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL YQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRFGTRAVYLASVA AFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDTGG ASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEA RVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQ VVFDKSDLAKYSA
UniProt accession: Q96JT2

Data

Human prostatic tissue stained with anti-Prostein antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of benign prostate glands.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Prostein (P501S) monoclonal antibody (ZR9) specifically react with?

This antibody is reactive with human tissues only.

For which application is the rabbit anti-Prostein (P501S) monoclonal antibody validated?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-Prostein monoclonal antibody be stored to maintain stability?

For short-term storage, keep at 2-8°C, and for long-term storage, freeze at -20°C while avoiding repeated freeze/thaw cycles.

What is the recommended dilution for using the concentrated form of this antibody in IHC?

The recommended dilution for the concentrated antibody when used in immunohistochemistry is 1:200.

What is the immunogen used to generate the rabbit anti-Prostein (P501S) monoclonal antibody (ZR9)?

The immunogen consists of synthesized peptides corresponding to the N-terminus of the human Prostein protein.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.