| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
rabbit anti-LMO-2 monoclonal antibody (ZR87) 6243
Price range: $160.00 through $528.00
Antibody summary
- Rabbit monoclonal to LMO-2
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG
- Control: Normal lymph node
- Visualization: Nuclear
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
rabbit anti-LMO-2 monoclonal antibody ZR87 6243
| antibody |
|---|
| Database link: human P25791 |
| Tested applications IHC |
| Recommended dilutions Concentrated 1:100-200 |
| Application Notes Positive control: Normal lymph node |
| Immunogen Recombinant human LMO2 protein fragment (around aa 23-140) (exact sequence is proprietary) |
| Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated |
| Form liquid |
| Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles. |
| Purity affinity purified |
| Clonality monoclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens LMO2 Rhombotin-2 |
| Protein names Rhombotin-2 |
| Alternative names Cysteine-rich protein TTG-2, LIM domain only protein 2, T-cell translocation protein 2 |
| Gene names LMO2 |
| Function Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state |
| Subcellular location Nucleus |
| Structure Interacts via its LIM domains with ELF2 and LDB1. Also interacts with basic helix-loop-helix protein TAL1/SCL and can assemble in a complex with LMO2 and TAL1/SCL (By similarity). Interacts with BEX2 and KDM5A |
| Keywords 3D-structure, Alternative splicing, Chromosomal rearrangement, LIM domain, Metal-binding, Nucleus, Proteomics identification, Proto-oncogene, Reference proteome, Repeat, Zinc |
| Sequence MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI |
| UniProt accession: P25791 |
Data
![]() |
| Formalin-fixed, paraffin-embedded human lymph node stained with anti-LMO2 antibody using peroxidase-conjugate and AEC chromogen. Note nuclear staining of germinal center cells |
FAQ & Publications
Frequently Asked Questions
What species does the rabbit anti-LMO-2 monoclonal antibody (ZR87) specifically react with?
This antibody is reactive with human species.
For which application is the rabbit anti-LMO-2 monoclonal antibody (ZR87) validated?
It is validated for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.
What are the recommended storage conditions for this antibody to maintain its stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C while avoiding freeze-thaw cycles.
What is the host species and clonality of the anti-LMO-2 antibody ZR87?
The antibody is a rabbit monoclonal antibody.
What is the immunogen used to generate the rabbit anti-LMO-2 monoclonal antibody (ZR87)?
The immunogen is a recombinant human LMO2 protein fragment approximately spanning amino acids 23 to 140, with the exact sequence proprietary.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.