Immunohistochemistry (IHC) : Human tonsil stained with anti-LEF1 using peroxidase conjugate and DAB chromogen. Note nuclear staining of subset of B cells.

rabbit anti-LEF1 monoclonal antibody (ZR336) 6241

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to LEF1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: CLL/SLL
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6241parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, LEF1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-LEF1 monoclonal antibody ZR336 6241

antibody
Database link: human Q9UJU2
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: CLL/SLL
Immunogen Fragment (around aa 100-200) of human LEF1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens LEF1 Lymphoid enhancer-binding factor 1
Protein names Lymphoid enhancer-binding factor 1
Alternative names T cell-specific transcription factor 1-alpha
Gene names LEF1
Protein family Belongs to the TCF/LEF family
Function Transcription factor that binds DNA in a sequence-specific manner (PubMed:2010090). Participates in the Wnt signaling pathway (By similarity). Activates transcription of target genes in the presence of CTNNB1 and EP300 (By similarity). PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1 (By similarity). TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1 (PubMed:11266540). Regulates T-cell receptor alpha enhancer function (PubMed:19653274). Required for IL17A expressing gamma-delta T-cell maturation and development, via binding to regulator loci of BLK to modulate expression (By similarity). Acts as a positive regulator of odontoblast differentiation during mesenchymal tooth germ formation, expression is repressed during the bell stage by MSX1-mediated inhibition of CTNNB1 signaling (By similarity). May play a role in hair cell differentiation and follicle morphogenesis (By similarity)
Subcellular location Nucleus
Structure Binds the armadillo repeat of CTNNB1 and forms a stable complex. Interacts with EP300, TLE1 and PIASG (By similarity). Binds ALYREF/THOC4, MDFI and MDFIC. Interacts with NLK. Interacts with DAZAP2 (PubMed:19304756)
Post-translational modification Phosphorylated at Thr-155 and/or Ser-166 by NLK. Phosphorylation by NLK at these sites represses LEF1-mediated transcriptional activation of target genes of the canonical Wnt signaling pathway
Involvement in disease Ectodermal dysplasia 17 with or without limb malformations A form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures such as hair, teeth, nails and sweat glands, with or without any additional clinical sign. Each combination of clinical features represents a different type of ectodermal dysplasia. ECTD17 is an autosomal dominant form characterized by hypohidrosis, dry skin, hair and tooth anomalies, and slow nail growth. Some patients have limb abnormalities such as radial ray defects, polydactyly, syndactyly, and split hand/foot malformation.
Keywords Activator, Alternative promoter usage, Alternative splicing, Direct protein sequencing, Disease variant, DNA-binding, Ectodermal dysplasia, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation, Wnt signaling pathway
Sequence MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM QLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI
UniProt accession: Q9UJU2

Data

Human tonsil stained with anti-LEF1 using peroxidase conjugate and DAB chromogen. Note nuclear staining of subset of B cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-LEF1 monoclonal antibody (ZR336) specifically react with?

This antibody is reactive with human tissues only.

Which applications is the rabbit anti-LEF1 monoclonal antibody (ZR336) validated for?

The antibody is suitable and tested for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this LEF1 antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided.

What is the host species and clonality of the anti-LEF1 antibody ZR336?

The antibody is a rabbit monoclonal antibody.

What dilutions are recommended when using the concentrated form of this LEF1 antibody for IHC?

The recommended dilution range for the concentrated antibody is 1:100 to 1:200 for immunohistochemistry.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.