Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human tonsil stained with anti-IgM antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of plasma cells

rabbit anti-IgM monoclonal antibody (ZR249) 6226

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to IgM
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Lymph node
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6226parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, IgM

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-IgM monoclonal antibody ZR249 6226

antibody
Database link: human P01871
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Lymph node
Immunogen Heavy chain of human IgM
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens IGHM Immunoglobulin heavy constant mu
Protein names Immunoglobulin heavy constant mu
Alternative names Ig mu chain C region, Ig mu chain C region BOT, Ig mu chain C region GAL, Ig mu chain C region OU
Gene names IGHM
Function Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268)
Subcellular location Cell membrane
Structure Part of IgM B cell receptor complex on pre-B cells, immature and mature B cells. The BCR complex consists of one membrane-bound IgM molecule responsible for antigen binding, non-covalently associated with CD79A and CD79B signaling chains
Post-translational modification N-glycosylated; important for IgM secretion and its localization at the plasma membrane. The interaction with FCMR is glycan-independent
Involvement in disease Agammaglobulinemia 1, autosomal recessive A primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life.
Keywords 3D-structure, Adaptive immunity, Alternative splicing, Cell membrane, Direct protein sequencing, Disulfide bond, Glycoprotein, Immunity, Immunoglobulin, Immunoglobulin domain, Membrane, Proteomics identification, Reference proteome, Secreted, Transmembrane, Transmembrane helix
Sequence GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVL RGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLPVIAELPPKVSVFVPPR DGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTS TLTIKESDWLGQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPSFASIFLTKST KLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAVGEASICEDDWNSGER FTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESATITCLVTGFSPAD VFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEAL PNRVTERTVDKSTEGEVSADEEGFENLWATASTFIVLFLLSLFYSTTVTLFKVK
UniProt accession: P01871

Data

Formalin-fixed, paraffin-embedded human tonsil stained with anti-IgM antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of plasma cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-IgM monoclonal antibody (ZR249) specifically react with?

This monoclonal antibody is reactive with human IgM.

What are the recommended storage conditions for the rabbit anti-IgM monoclonal antibody (ZR249) to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.