Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human tonsil stained with anti-IgG antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of plasma cells

rabbit anti-IgG monoclonal antibody ZR247 6223

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to IgG
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Lymph node
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6223parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, IgG

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-IgG monoclonal antibody ZR247 6223

antibody
Database link: human P01857
Tested applications IHC
Recommended dilutions Concentrated 1:50-200
Application Notes Positive control: Lymph node
Immunogen Recombinant full-length human IGHG protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens IGHG1 Immunoglobulin heavy constant gamma 1
Protein names Immunoglobulin heavy constant gamma 1
Alternative names Ig gamma-1 chain C region, Ig gamma-1 chain C region EU, Ig gamma-1 chain C region KOL, Ig gamma-1 chain C region NIE
Gene names IGHG1
Function Constant region of immunoglobulin (Ig) heavy chains. Igs are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound Igs serve as receptors, which upon binding to a specific antigen trigger the clonal expansion and differentiation of B lymphocytes into Ig-secreting plasma cells. Secreted Igs known as antibodies mediate the effector phase of humoral immunity by blocking the interaction of infectious antigens with cellular receptors (via the antigen-binding region) and eliciting effector mechanisms that lead to pathogen neutralization (via the constant region) (PubMed:17576170, PubMed:20176268, PubMed:22158414). The antigen-binding region is formed by the variable domain of one heavy chain paired with the variable domain of its associated light chain. Each Ig molecule has two antigen-binding sites with remarkable affinity for a particular antigen due to V-(D)-J rearrangement, somatic hypermutations and affinity maturation of the variable domains upon antigen exposure (PubMed:17576170, PubMed:20176268, PubMed:22158414). The constant region defines the Ig isotype that perform distinct sets of effector functions. B cells diversify and rearrange their Ig constant regions through class-switch recombination, a process by which the constant region is switched from one Ig isotype to another, namely from IgM and IgD to IgG, IgA and IgE (PubMed:17576170, PubMed:20176268, PubMed:22158414). The constant region of Ig gamma-1 (IgG1) isotype interacts (via the fragment crystallizable, Fc) with receptors on innate immune cells and the complement system to mediate humoral effector functions, including antibody-dependent cellular cytotoxicity or phagocytosis, complement-dependent cytotoxicity and inflammatory responses
Subcellular location Cell membrane
Structure (Microbial infection) Interacts (via Fc region) with S. aureus spa/protein A (via B domain); spa interferes with the formation of IgG:C1q complexes preventing complement activation and protecting bacteria from phagocytic killing
Post-translational modification N-glycosylated. Carries predominantly biantennary complex-type glycans attached at Asn-180 residue on the Fc region of each heavy chain. Unique Fc glycan profiles found in secreted IgGs are induced in an antigen-specific way, likely programmed during B cell priming to mount an appropriate Ig effector response (PubMed:10818239, PubMed:10917521, PubMed:21768335, PubMed:22184099, PubMed:25561553, PubMed:29133956, PubMed:29445378). The core glycan is composed of two sequential N-acetylglucosamine (GlcNAc) moieties followed by a central mannose (Man) from which two additional Man residues branch out (alpha1,3 and alpha1,6 antennae) each capped with a GlcNAc. Additional sugar molecules can be added to generate over 30 possible glycans. Such sugar modifications include the addition of one fucose at the initial GlcNAc, galactose (Gal) and sialic acid (Neu5Ac) residues at antennary GlcNAc or a bisecting GlcNAc to the core Man (PubMed:10818239, PubMed:22184099, PubMed:29133956, PubMed:38383719). Variable addition of sugars account for different IgG functional states associated with antibody-dependent cellular cytotoxicity or phagocytosis and inflammatory responses such as complement activation and cytokine secretion. Fc N-glycan diversity is further enhanced by asymmetric glycan pairing on the heavy chains (PubMed:10818239, PubMed:20357243, PubMed:22184099, PubMed:29133956). Fc N-glycan sialylation is linked to anti-inflammatory effects. It regulates Fc effector functions through conformational changes leading to preferential interaction with type II Fc receptors while reducing binding to type I Fc receptors. During plasmablast response, sialylated Fc domains within immune complexes signal via FCER2/CD23 and drive the selection of B cells with high affinity for antigen (PubMed:18420934, PubMed:22184099, PubMed:25733881, PubMed:26140596). Fc Igs carrying afucosylated N-glycans preferentially activate FCGR3A, antigen-dependent cellular cytotoxicity and antitumor immunity (PubMed:12427744, PubMed:21768335, PubMed:28566370, PubMed:30061887, PubMed:36867679) (Microbial infection) Deglycosylation on Asn-180 by S. pyogenes EndoS or Endos2 endoglucosidases prevents interaction between immunoglobulin-gamma (IgG) and Fc receptors, impairing ability to activate the complement pathway
Involvement in disease Multiple myeloma A malignant tumor of plasma cells usually arising in the bone marrow and characterized by diffuse involvement of the skeletal system, hyperglobulinemia, Bence-Jones proteinuria and anemia. Complications of multiple myeloma are bone pain, hypercalcemia, renal failure and spinal cord compression. The aberrant antibodies that are produced lead to impaired humoral immunity and patients have a high prevalence of infection. Amyloidosis may develop in some patients. Multiple myeloma is part of a spectrum of diseases ranging from monoclonal gammopathy of unknown significance (MGUS) to plasma cell leukemia.
Keywords 3D-structure, Adaptive immunity, Alternative splicing, Cell membrane, Chromosomal rearrangement, Direct protein sequencing, Disulfide bond, Glycoprotein, Immunity, Immunoglobulin, Immunoglobulin domain, Membrane, Proteomics identification, Reference proteome, Secreted, Transmembrane, Transmembrane helix
Sequence ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLL SVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA
UniProt accession: P01857

Data

Formalin-fixed, paraffin-embedded human tonsil stained with anti-IgG antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of plasma cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-IgG monoclonal antibody ZR247 6223 specifically react with?

This antibody specifically reacts with human IgG.

What are the recommended storage conditions for maintaining the stability of the rabbit anti-IgG monoclonal antibody ZR247 6223?

Store the antibody at 2-8°C for short term use, and for longer-term storage, keep it at -20°C while avoiding freeze/thaw cycles.

What applications is the rabbit anti-IgG monoclonal antibody ZR247 6223 validated for, and what dilution ranges are recommended?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues, with recommended dilutions of 1:50 to 1:200 when using the concentrated form.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.