Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human tonsil stained with anti-IgA antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of plasma cells

rabbit anti-IgA monoclonal antibody (ZR291) 6221

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to IgA
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Lymph node
Visualization: Cytoplasmic, cell surface
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6221parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, IgA

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-IgA monoclonal antibody ZR291 6221

antibody
Database link: human P01876
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Lymph node
Immunogen Full-length native protein (purified) corresponding to Human IgA
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens IGHA1 Immunoglobulin heavy constant alpha 1
Protein names Immunoglobulin heavy constant alpha 1
Alternative names Ig alpha-1 chain C region, Ig alpha-1 chain C region BUR, Ig alpha-1 chain C region TRO
Gene names IGHA1
Function Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268). Ig alpha is the major immunoglobulin class in body secretions (PubMed:2241915)
Subcellular location Cell membrane
Structure Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked (PubMed:20176268). Monomeric or polymeric (PubMed:2241915). Part of the secretory IgA (sIgA) complex that consists of two, four or five IgA monomers, and two additional non-Ig polypeptides, namely the JCHAIN and the secretory component (the proteolytic product of PIGR)
Post-translational modification 3-Hydroxykynurenine, an oxidized tryptophan metabolite that is common in biological fluids, reacts with alpha-1-microglobulin to form heterogeneous polycyclic chromophores including hydroxanthommatin. The chromophore reacts with accessible cysteines forming non-reducible thioether cross-links with Ig alpha-1 chain C region Cys-352 N- and O-glycosylated. N-glycan at Asn-144: Hex5HexNAc4
Keywords 3D-structure, Adaptive immunity, Alternative splicing, Cell membrane, Chromophore, Chromosomal rearrangement, Direct protein sequencing, Disulfide bond, Glycoprotein, Immunity, Immunoglobulin, Immunoglobulin domain, Membrane, Proteomics identification, Reference proteome, Secreted, Transmembrane, Transmembrane helix
Sequence ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDAS GDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSP SCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLC GCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEEL ALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRV AAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEEETPGANL WPTTITFLTLFLLSLFYSTALTVTSVRGPSGNREGPQY
UniProt accession: P01876

Data

Formalin-fixed, paraffin-embedded human tonsil stained with anti-IgA antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of plasma cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-IgA monoclonal antibody (ZR291) specifically react with?

The rabbit anti-IgA monoclonal antibody (ZR291) specifically reacts with human IgA.

What are the recommended storage conditions for maintaining the stability of this antibody?

For short-term storage, keep the antibody at 2-8°C; for longer-term storage, it should be stored at -20°C. Avoid freeze-thaw cycles to maintain antibody integrity.

What applications has this monoclonal antibody been validated for, and what is the suggested dilution for use?

This antibody has been tested and recommended for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with a suggested dilution of 1:100-200 when using the concentrated form.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.