Immunohistochemistry (IHC) : Human tonsil stained with anti-Granzyme B antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic granular staining of cytotoxic T-cells.

rabbit anti-Granzyme B monoclonal antibody (ZR432) 6203

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Granzyme B
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil
Visualization: Granular cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6203parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Granzyme B, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Granzyme B monoclonal antibody ZR432 6203

antibody
Database link: human P10144
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil
Immunogen Recombinant human GZMB protein fragment (around aa 73-187)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens GZMB Granzyme B
Protein names Granzyme B
Alternative names C11, CTLA-1, Cathepsin G-like 1, Cytotoxic T-lymphocyte proteinase 2, Fragmentin-2, Granzyme-2, Human lymphocyte protein, SECT, T-cell serine protease 1-3E
Gene names GZMB
Protein family Belongs to the peptidase S1 family. Granzyme subfamily
Function Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse (PubMed:1985927, PubMed:3262682, PubMed:3263427). It cleaves after Asp (PubMed:1985927, PubMed:8258716). Once delivered into the target cell, acts by catalyzing cleavage of gasdermin-E (GSDME), releasing the pore-forming moiety of GSDME, thereby triggering pyroptosis and target cell death (PubMed:31953257, PubMed:32188940). Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -9 and -10 (CASP3, CASP9 and CASP10, respectively) to give rise to active enzymes mediating apoptosis (PubMed:9852092). Cleaves and activates CASP7 in response to bacterial infection, promoting plasma membrane repair (By similarity)
Catalytic activity Preferential cleavage: -Asp-\|-Xaa- >> -Asn-\|-Xaa- > -Met-\|-Xaa-, -Ser-\|-Xaa-.
Subcellular location Secreted, Cytolytic granule
Keywords 3D-structure, Apoptosis, Cytolysis, Direct protein sequencing, Disulfide bond, Glycoprotein, Hydrolase, Lysosome, Protease, Proteomics identification, Reference proteome, Secreted, Serine protease, Signal, Zymogen
Sequence MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVL TAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKR TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHY YDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI KKTMKRY
UniProt accession: P10144

Data

Human tonsil stained with anti-Granzyme B antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic granular staining of cytotoxic T-cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Granzyme B monoclonal antibody (ZR432) specifically react with?

This antibody is reactive with human specimens.

Which application is this antibody validated for and what is the recommended dilution?

The antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with a recommended dilution of 1:100-200 for the concentrated form.

What are the storage conditions for the rabbit anti-Granzyme B monoclonal antibody?

Store the antibody at 2-8°C for short-term use and at -20°C for long-term storage, while avoiding freeze/thaw cycles.

What is the host species and clonality of this anti-Granzyme B antibody?

The antibody is a rabbit monoclonal antibody with IgG isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.