Immunohistochemistry (IHC) : Human tonsil stained with anti-FoxP1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of follicular and mantle B-cells.

rabbit anti-FoxP1 monoclonal antibody (ZR333) 6185

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to FoxP1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6185parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, FoxP1, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-FoxP1 monoclonal antibody ZR333 6185

antibody
Database link: human Q9H334
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil
Immunogen Recombinant Human FOXP1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens FOXP1 Forkhead box protein P1
Protein names Forkhead box protein P1
Alternative names Mac-1-regulated forkhead
Gene names FOXP1
Function Transcriptional repressor (PubMed:18347093, PubMed:26647308). Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential (By similarity). Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal cord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in embryonic stem cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T(FH)s. Involved in maintenance of hair follicle stem cell quiescence; the function probably involves regulation of FGF18 (By similarity). Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis (PubMed:25267198). Binds to CSF1R promoter elements and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes seems to involve NCOR2 as corepressor (PubMed:15286807, PubMed:18347093, PubMed:18799727). Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization seems to implicate suppression of SEMA5B (PubMed:24023716). Can negatively regulate androgen receptor signaling (PubMed:18640093). Acts as a transcriptional activator of the FBXL7 promoter; this activity is regulated by AURKA (PubMed:28218735)
Subcellular location Nucleus
Structure Forms homodimers and heterodimers with FOXP2 and FOXP4 (PubMed:25027557). Dimerization is required for DNA-binding. Self-associates (PubMed:26647308). Interacts with CTBP1 (By similarity). Interacts with NCOR2 and AR (PubMed:18347093, PubMed:18640093). Interacts with FOXP2 (PubMed:26647308). Interacts with TBR1 (PubMed:30250039). Interacts with AURKA; this interaction facilitates the phosphorylation of FOXP1, which suppresses the expression of FBXL7 (PubMed:28218735). Interacts with ZMYM2 (PubMed:32891193)
Involvement in disease Intellectual developmental disorder with language impairment and with or without autistic features A developmental disorder characterized by mild to moderate intellectual disability, language impairment, and autistic features in some patients. Patients show global delay, delayed walking, severely delayed speech development, and behavioral abnormalities, including irritability, hyperactivity, aggression, and stereotypical rigid behaviors.
Keywords 3D-structure, Alternative splicing, Chromosomal rearrangement, Disease variant, DNA-binding, Intellectual disability, Isopeptide bond, Metal-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repressor, Transcription, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger
Sequence MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQ ALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQV LSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLA FQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHT AEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSH PLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQLELQLAKDKE RLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQG PSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILE SPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVE FQKRRPQKISGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLAS AIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPD FDHDRDYEDEPVNEDME
UniProt accession: Q9H334

Data

Human tonsil stained with anti-FoxP1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of follicular and mantle B-cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-FoxP1 monoclonal antibody (ZR333) specifically react with?

This antibody is reactive with human species only.

Which applications has the rabbit anti-FoxP1 monoclonal antibody been validated for?

The antibody has been tested and recommended for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this antibody to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, and freeze/thaw cycles should be avoided.

What types of antibody formats and concentrations are available for the rabbit anti-FoxP1 monoclonal antibody?

The antibody is available as concentrated formats in 0.1 mL, 0.5 mL, and 1.0 mL volumes, as well as a 7 mL prediluted format.

What control tissue is recommended to validate staining specificity when using this antibody in IHC?

Human tonsil tissue is recommended as a positive control for immunohistochemical validation of this antibody.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.