rabbit anti-ERK1 monoclonal antibody 9031

$409.00

Antibody summary

Rabbit monoclonal to ERK1
Suitable for: WB
Reacts with: human, mouse
Isotype: IgG1
100 µg

SKU: 9031 Categories: antibody, loading control Tag: ERK1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	monoclonal
concentration	1 mg/mL
applications	WB
available sizes	100 µg

rabbit anti-ERK1 monoclonal antibody 9031

antibody
Database link: human ERK1 P27361
Tested applications WB
Recommended dilutions WB: 1:1000-10000
Immunogen Recombinant full length ERK1 protein.
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions -20°C for 2 years or more. °Centrifuge after first thaw to maximize product recovery. Aliquot to avoid repeated freeze-thaw cycles. Store aliquots at 4°C for several days to weeks.
Storage buffer PBS, pH 7.2, 0.05% NaN₃
Purity affinity purified
Clonality polyclonal
Isotype IgG
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Rabbit polycolonal - Isotype Control

target relevance
Homo sapiens MAPK3 Mitogen-activated protein kinase 3
Protein names Mitogen-activated protein kinase 3
Alternative names ERT2, Extracellular signal-regulated kinase 1, Insulin-stimulated MAP2 kinase, MAP kinase isoform p44, Microtubule-associated protein 2 kinase, p44-ERK1
Gene names MAPK3
Protein family Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily
Function Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed:34497368). MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade also plays a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, DEPTOR, FRS2 or GRB10) (PubMed:35216969). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. Phosphorylates GJA1 at 'Ser-279' and 'Ser-282' resulting in an increase in GJA1 ubiquitination and ultimately lysosomal degradation (By similarity)
Catalytic activity L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+) L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+)
Subcellular location Cytoplasm, Nucleus, Membrane, caveola, Cell junction, focal adhesion
Structure (Microbial infection) Binds to HIV-1 Nef through its SH3 domain. This interaction inhibits its tyrosine-kinase activity
Post-translational modification Phosphorylated upon KIT and FLT3 signaling (By similarity). Dually phosphorylated on Thr-202 and Tyr-204, which activates the enzyme. Ligand-activated ALK induces tyrosine phosphorylation. Dephosphorylated by PTPRJ at Tyr-204 Ubiquitinated by TRIM15 via 'Lys-63'-linked ubiquitination; leading to activation. Deubiquitinated by CYLD
Keywords 3D-structure, Acetylation, Alternative splicing, Apoptosis, ATP-binding, Cell cycle, Cell junction, Cytoplasm, Direct protein sequencing, Host-virus interaction, Kinase, Membrane, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Transferase, Ubl conjugation
Sequence MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL KELIFQETARFQPGVLEAP
UniProt accession: P27361

Data

benchmarkantibodies.com/wp-content/uploads/2024/03/9031_1.jpg

Detection of human ERK1 by western blot. Samples: Whole cell lysate from HeLa (5, 15 and 50 µg) and HEK293T (T; 50 µg) cells. Antibodies: Affinity purified rabbit anti-ERK1 antibody used for WB at 0.04 µg/ml. Detection: Chemiluminescence with exposure time of 30 seconds.

benchmarkantibodies.com/wp-content/uploads/2024/03/9031_2.jpg

Detection of human ERK1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-ERK1 antibody used for IP at 3 µg/mg lysate. For blotting immunoprecipitated ERK1, the antibody was used at 1.0 µg/ml. Detection: Chemiluminescence with exposure time of 3 seconds.

benchmarkantibodies.com/wp-content/uploads/2024/03/9031_3.jpg

Detection of human ERK1 by immunohistochemistry. Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-ERK1 antibody used at a dilution of 1:200 (1µg/ml). Detection: DAB

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-ERK1 monoclonal antibody 9031 react with?

This antibody reacts with human and mouse ERK1 proteins.

What applications is the rabbit anti-ERK1 monoclonal antibody 9031 suitable for?

The antibody is suitable for Western blot (WB) applications.

How should the rabbit anti-ERK1 monoclonal antibody 9031 be stored to maintain stability?

Store the antibody at -20°C for up to 2 years. After the first thaw, centrifuge to maximize product recovery, aliquot to avoid repeated freeze-thaw cycles, and keep aliquots at 4°C for several days to weeks.

What is the concentration and form of the rabbit anti-ERK1 monoclonal antibody 9031?

The antibody is supplied as a liquid at a concentration of 1 mg/mL.

What is the immunogen used to generate the rabbit anti-ERK1 monoclonal antibody 9031?

The immunogen is recombinant full-length ERK1 protein.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.