Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human tonsil stained with anti-CD43 antibody using peroxidase-conjugate and DAB chromogen. Note the cell membrane staining of perifollicular T-cells

rabbit anti-CD43 monoclonal antibody (ZR403) 6094

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD43
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil, CLL/SLL, or lymph node
Visualization: Cell membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6094parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD43, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD43 monoclonal antibody ZR403 6094

antibody
Database link: human P16150
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil, CLL/SLL, or lymph node
Immunogen Recombinant full-length human SPN protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens SPN Leukosialin
Protein names Leukosialin
Alternative names GPL115, Galactoglycoprotein, Leukocyte sialoglycoprotein, Sialophorin
Gene names SPN
Function Predominant cell surface sialoprotein of leukocytes which regulates multiple T-cell functions, including T-cell activation, proliferation, differentiation, trafficking and migration. Positively regulates T-cell trafficking to lymph-nodes via its association with ERM proteins (EZR, RDX and MSN) (By similarity). Negatively regulates Th2 cell differentiation and predisposes the differentiation of T-cells towards a Th1 lineage commitment. Promotes the expression of IFN-gamma by T-cells during T-cell receptor (TCR) activation of naive cells and induces the expression of IFN-gamma by CD4(+) T-cells and to a lesser extent by CD8(+) T-cells (PubMed:18036228). Plays a role in preparing T-cells for cytokine sensing and differentiation into effector cells by inducing the expression of cytokine receptors IFNGR and IL4R, promoting IFNGR and IL4R signaling and by mediating the clustering of IFNGR with TCR (PubMed:24328034). Acts as a major E-selectin ligand responsible for Th17 cell rolling on activated vasculature and recruitment during inflammation. Mediates Th17 cells, but not Th1 cells, adhesion to E-selectin. Acts as a T-cell counter-receptor for SIGLEC1 (By similarity)
Subcellular location Nucleus, Nucleus, PML body
Structure Monomer (By similarity). Interacts with CTNNB1 (PubMed:15003504). Interacts with RDX (via FERM domain), EZR and MSN (By similarity)
Post-translational modification Glycosylated; has a high content of sialic acid and O-linked carbohydrate structures Phosphorylation at Ser-355 is regulated by chemokines, requires its association with ERM proteins (EZR, RDX and MSN) and is essential for its function in the regulation of T-cell trafficking to lymph nodes Has a high content of sialic acid and O-linked carbohydrate structures Cleavage by CTSG releases its extracellular domain and triggers its intramembrane proteolysis by gamma-secretase releasing the CD43 cytoplasmic tail chain (CD43-ct) which translocates to the nucleus Sumoylated
Keywords Cell projection, Direct protein sequencing, Glycoprotein, Membrane, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix, Ubl conjugation
Sequence MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGD QTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPI TANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSK GTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNA STVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVV DAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEE LKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
UniProt accession: P16150

Data

Formalin-fixed, paraffin-embedded human tonsil stained with anti-CD43 antibody using peroxidase-conjugate and DAB chromogen. Note the cell membrane staining of perifollicular T-cells

FAQ & Publications

Frequently Asked Questions

What is the recommended application and dilution range for the rabbit anti-CD43 monoclonal antibody (ZR403)?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. For concentrated antibody, the recommended dilution range is 1:100 to 1:200.

How should the rabbit anti-CD43 monoclonal antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C. Avoid repeated freeze-thaw cycles to preserve antibody integrity.

What is the host species and clonality of the anti-CD43 antibody, and against which species does it react?

The antibody is a rabbit monoclonal IgG. It specifically reacts with human CD43 protein.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.