Immunohistochemistry (IHC) : Human lymph node stained with anti-CD43 antibody using peroxidase-conjugate and DAB chromogen. Note the cell membrane staining of perifollicular T-cells.

mouse anti-CD43 monoclonal antibody (DF-T1) 6093

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD43
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Tonsil, CLL/SLL, or lymph node
Visualization: Cell membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6093parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD43, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD43 monoclonal antibody DF-T1 6093

antibody
Database link: human P16150
Tested applications IHC
Recommended dilutions Concentrated 1:100
Application Notes Positive control: Tonsil, CLL/SLL, or lymph node
Immunogen Stimulated human leukocytes
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens SPN Leukosialin
Protein names Leukosialin
Alternative names GPL115, Galactoglycoprotein, Leukocyte sialoglycoprotein, Sialophorin
Gene names SPN
Function Predominant cell surface sialoprotein of leukocytes which regulates multiple T-cell functions, including T-cell activation, proliferation, differentiation, trafficking and migration. Positively regulates T-cell trafficking to lymph-nodes via its association with ERM proteins (EZR, RDX and MSN) (By similarity). Negatively regulates Th2 cell differentiation and predisposes the differentiation of T-cells towards a Th1 lineage commitment. Promotes the expression of IFN-gamma by T-cells during T-cell receptor (TCR) activation of naive cells and induces the expression of IFN-gamma by CD4(+) T-cells and to a lesser extent by CD8(+) T-cells (PubMed:18036228). Plays a role in preparing T-cells for cytokine sensing and differentiation into effector cells by inducing the expression of cytokine receptors IFNGR and IL4R, promoting IFNGR and IL4R signaling and by mediating the clustering of IFNGR with TCR (PubMed:24328034). Acts as a major E-selectin ligand responsible for Th17 cell rolling on activated vasculature and recruitment during inflammation. Mediates Th17 cells, but not Th1 cells, adhesion to E-selectin. Acts as a T-cell counter-receptor for SIGLEC1 (By similarity)
Subcellular location Nucleus, Nucleus, PML body
Structure Monomer (By similarity). Interacts with CTNNB1 (PubMed:15003504). Interacts with RDX (via FERM domain), EZR and MSN (By similarity)
Post-translational modification Glycosylated; has a high content of sialic acid and O-linked carbohydrate structures Phosphorylation at Ser-355 is regulated by chemokines, requires its association with ERM proteins (EZR, RDX and MSN) and is essential for its function in the regulation of T-cell trafficking to lymph nodes Has a high content of sialic acid and O-linked carbohydrate structures Cleavage by CTSG releases its extracellular domain and triggers its intramembrane proteolysis by gamma-secretase releasing the CD43 cytoplasmic tail chain (CD43-ct) which translocates to the nucleus Sumoylated
Keywords Cell projection, Direct protein sequencing, Glycoprotein, Membrane, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix, Ubl conjugation
Sequence MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGD QTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPI TANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSK GTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNA STVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVV DAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEE LKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
UniProt accession: P16150

Data

Human lymph node stained with anti-CD43 antibody using peroxidase-conjugate and DAB chromogen. Note the cell membrane staining of perifollicular T-cells.

FAQ & Publications

Frequently Asked Questions

What species is the mouse anti-CD43 monoclonal antibody (DF-T1) reactive with?

This antibody is reactive with human species.

For which application is the mouse anti-CD43 monoclonal antibody (DF-T1) validated?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-CD43 monoclonal antibody (DF-T1) be stored to maintain stability?

Store the antibody at 2-8°C for short-term use and at -20°C for long-term storage, avoiding freeze/thaw cycles to preserve antibody integrity.

What is the recommended dilution for using the concentrated mouse anti-CD43 monoclonal antibody in IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is 1:100.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.