Immunohistochemistry (IHC) : Human tonsil stained with anti-CD38 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of perifollicular and subepithelial plasma cells.

rabbit anti-CD38 monoclonal antibody (ZR351) 6090

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD38
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6090parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD38, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD38 monoclonal antibody ZR351 6090

antibody
Database link: human P28907
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil
Immunogen Peptide derived from the C-terminus of human CD38 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CD38 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
Protein names ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
Alternative names 2'-phospho-ADP-ribosyl cyclase, 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase, 2'-phospho-cyclic-ADP-ribose transferase, ADP-ribosyl cyclase 1, Cyclic ADP-ribose hydrolase 1, T10
Gene names CD38
Protein family Belongs to the ADP-ribosyl cyclase family
Function Multifunctional transmembrane glycoprotein able to exert enzymatic activities and also to mobilize calcium, to transduce signals, to adhere to hyaluronan and to other ligands. Synthesizes cyclic ADP-ribose (cADPR), a second messenger for glucose-induced insulin secretion (PubMed:7961800, PubMed:8253715). Synthesizes the Ca(2+) mobilizer nicotinate-adenine dinucleotide phosphate, NAADP(+), from 2'-phospho-cADPR and nicotinic acid, as well as from NADP(+) and nicotinic acid. At both pH 5.0 and pH 7.4 preferentially transforms 2'-phospho-cADPR into NAADP(+), while preferentially cleaving NADP(+) to cADPR and ADPRP rather than into NADDP(+) (PubMed:16690024). Has cADPR hydrolase activity (PubMed:7961800, PubMed:8253715). Functions also as a receptor that binds the ligand CD31 on endothelial cells, promoting lymphocyte activation, proliferation, and migration across the endothelial barrier (PubMed:9551996). Involved in the regulation of crucial dendritic cell functions acquired at the mature stage, such as CCL21-driven migration, survival, and Th1-polarizing activity (PubMed:16293598). In lamina propria T lymphocytes, CD38/CD31 cognate interactions initiate a multistep signaling pathway resulting in activation of LCK anf LAT, followed by cytokine release (PubMed:11259373)
Catalytic activity 2'-phospho-cyclic ADP-ribose + nicotinate = NAADP(+) NAD(+) = cyclic ADP-beta-D-ribose + nicotinamide + H(+) NAD(+) + H2O = ADP-D-ribose + nicotinamide + H(+) cyclic ADP-beta-D-ribose + H2O = ADP-D-ribose NADP(+) = 2'-phospho-cyclic ADP-ribose + nicotinamide nicotinate + NADP(+) = NAADP(+) + nicotinamide
Subcellular location Cell surface, Cell membrane
Structure Homodimer
Keywords 3D-structure, Alternative splicing, Cell membrane, Diabetes mellitus, Disulfide bond, Glycoprotein, Hydrolase, Membrane, NAD, NADP, Proteomics identification, Receptor, Reference proteome, Signal-anchor, Transferase, Transmembrane, Transmembrane helix
Sequence MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFP ETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC SNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
UniProt accession: P28907

Data

Human tonsil stained with anti-CD38 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of perifollicular and subepithelial plasma cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-CD38 monoclonal antibody (ZR351) specifically react with?

This antibody specifically reacts with human species.

Which application is the rabbit anti-CD38 monoclonal antibody (ZR351) validated for?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-CD38 monoclonal antibody (ZR351) be stored for optimal stability?

For short term storage, keep at 2-8°C; for longer term storage, keep at -20°C and avoid freeze/thaw cycles.

What is the recommended dilution range for using the concentrated rabbit anti-CD38 monoclonal antibody (ZR351) in IHC?

The recommended dilution for the concentrated antibody is between 1:100 and 1:200.

What is the immunogen used to generate the rabbit anti-CD38 monoclonal antibody (ZR351)?

The immunogen is a peptide derived from the C-terminus of the human CD38 protein.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.