Immunohistochemistry (IHC) : Human Hodgkin lymphoma stained with anti-CD30 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of Hodgkin’s cells.

rabbit anti-CD30 monoclonal antibody (ZR248) 6084

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD30
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Hodgkin lymphoma or anaplastic large cell lymphoma
Visualization: Cell membrane and cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6084parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD30, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD30 monoclonal antibody ZR248 6084

antibody
Database link: human P28908
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Hodgkin lymphoma or anaplastic large cell lymphoma
Immunogen Recombinant human full-length TNFRSF8 protein (CD30)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens TNFRSF8 Tumor necrosis factor receptor superfamily member 8
Protein names Tumor necrosis factor receptor superfamily member 8
Alternative names CD30L receptor, Ki-1 antigen, Lymphocyte activation antigen CD30
Gene names TNFRSF8
Protein family Belongs to the TNFR8 family
Function Receptor for TNFSF8/CD30L (PubMed:8391931). May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B (PubMed:8999898)
Subcellular location Cytoplasm
Structure Interacts with TRAF1, TRAF2, TRAF3 and TRAF5
Post-translational modification Phosphorylated on serine and tyrosine residues (Probable). Isoform 2 is constitutively phosphorylated (PubMed:8839832)
Keywords 3D-structure, Alternative initiation, Alternative splicing, Cell membrane, Cytoplasm, Disulfide bond, Glycoprotein, Membrane, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
UniProt accession: P28908

Data

Human Hodgkin lymphoma stained with anti-CD30 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of Hodgkin's cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-CD30 monoclonal antibody (ZR248) specifically react with?

This antibody specifically reacts with human CD30 protein.

For which applications is the rabbit anti-CD30 monoclonal antibody (ZR248) validated?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-CD30 monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, store at -20°C and avoid freeze/thaw cycles.

What is the recommended dilution range when using the concentrated form of this anti-CD30 antibody for IHC?

The recommended dilution for the concentrated antibody in IHC is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.