Immunohistochemistry (IHC) : Formalin-Fixed, paraffin-embedded human thymus stained with anti-CD27 antibody using peroxidase-conjugate and DAB chromogen. Note the cell surface staining of medullary T cells

rabbit anti-CD27 monoclonal antibody (ZR402) 6080

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD27
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Thymus
Visualization: Cell surface
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6080parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD27, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD27 monoclonal antibody ZR402 6080

antibody
Database link: human P26842
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Thymus
Immunogen Recombinant human CD27 protein fragment (aa 28-170)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CD27 CD27 antigen
Protein names CD27 antigen
Alternative names CD27L receptor, T-cell activation antigen CD27, T14, Tumor necrosis factor receptor superfamily member 7
Gene names CD27
Function Costimulatory immune-checkpoint receptor expressed at the surface of T-cells, NK-cells and B-cells which binds to and is activated by its ligand CD70/CD27L expressed by B-cells (PubMed:28011863). The CD70-CD27 signaling pathway mediates antigen-specific T-cell activation and expansion which in turn provides immune surveillance of B-cells (PubMed:28011863). Mechanistically, CD70 ligation activates the TRAF2-PTPN6 axis that subsequently inhibits LCK phosphorylation to promote phenotypic and transcriptional adaptations of T-cell memory (PubMed:38354704). In addition, activation by CD70 on early progenitor cells provides a negative feedback signal to leukocyte differentiation during immune activation and thus modulates hematopoiesis (By similarity). Negatively regulates the function of Th2 lymphocytes in the adipose tissue (By similarity)
Subcellular location Cell membrane
Structure Homodimer (PubMed:1655907, PubMed:34419446). Interacts with SIVA1; may play a role in apoptosis through association with SIVA1 (PubMed:9177220). Interacts with TRAF2 (PubMed:38354704, PubMed:9692890). Interacts ith PTPN6 (PubMed:38354704)
Post-translational modification Phosphorylated N-glycosylated O-glycosylated with core 1 or possibly core 8 glycans
Involvement in disease Lymphoproliferative syndrome 2 An autosomal recessive immunodeficiency disorder associated with persistent symptomatic EBV viremia, hypogammaglobulinemia, and impaired T-cell-dependent B-cell responses and T-cell dysfunction. The phenotype is highly variable, ranging from asymptomatic borderline-low hypogammaglobulinemia, to a full-blown symptomatic systemic inflammatory response with life-threatening EBV-related complications, including hemophagocytic lymphohistiocytosis, a lymphoproliferative disorder, and malignant lymphoma requiring stem cell transplantation.
Keywords 3D-structure, Apoptosis, Cell membrane, Direct protein sequencing, Disease variant, Disulfide bond, Glycoprotein, Membrane, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAA QCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPP QRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCHYSCPREE EGSTIPIQEDYRKPEPACSP
UniProt accession: P26842

Data

Formalin-Fixed, paraffin-embedded human thymus stained with anti-CD27 antibody using peroxidase-conjugate and DAB chromogen. Note the cell surface staining of medullary T cells

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-CD27 monoclonal antibody (ZR402) reactive with?

This antibody specifically reacts with human CD27 protein.

What are the recommended storage conditions for maintaining the stability of this anti-CD27 antibody?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, freeze it at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

Which applications has the rabbit anti-CD27 monoclonal antibody (ZR402) been validated for, and what are the suggested dilutions?

This antibody has been tested and validated for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. The recommended dilution for the concentrated antibody is 1:100-200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.