Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human tonsil stained with anti-CD2 antibody using peroxidase-conjugate and DAB chromogen. Note membrane and cytoplasmic staining of perifollicular T cells

rabbit anti-CD2 monoclonal antibody (ZR100) 6070

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil
Visualization: Membranous, cell surface
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6070parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD2, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD2 monoclonal antibody ZR100 6070

antibody
Database link: human P06729
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil
Immunogen Recombinant fragment of human CD2 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CD2 T-cell surface antigen CD2
Protein names T-cell surface antigen CD2
Alternative names Erythrocyte receptor, LFA-2, LFA-3 receptor, Rosette receptor, T-cell surface antigen T11/Leu-5
Gene names CD2
Function CD2 interacts with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function
Subcellular location Cell membrane
Structure Interacts with CD48 (By similarity). Interacts with CD58 (LFA-3) (PubMed:10380930). Interacts with CD2AP (By similarity). Interacts with PSTPIP1 (PubMed:9857189). Interacts with FCGR3A; this interaction modulates NK cell activation and cytotoxicity
Keywords 3D-structure, Cell adhesion, Cell membrane, Disulfide bond, Glycoprotein, Immunoglobulin domain, Membrane, Proteomics identification, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN
UniProt accession: P06729

Data

Formalin-fixed, paraffin-embedded human tonsil stained with anti-CD2 antibody using peroxidase-conjugate and DAB chromogen. Note membrane and cytoplasmic staining of perifollicular T cells

FAQ & Publications

Frequently Asked Questions

What species reactivity does the rabbit anti-CD2 monoclonal antibody (ZR100) have?

This antibody is reactive with human species and is validated for use on human tissue samples.

Which applications is the rabbit anti-CD2 monoclonal antibody suitable for?

The antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

How should the rabbit anti-CD2 monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store at -20°C and avoid repeated freeze/thaw cycles.

What is the recommended dilution range for using the concentrated form of this antibody in immunohistochemistry?

The recommended dilution for the concentrated antibody in IHC applications is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.