Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human tonsil stained with anti-CD138 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of plasma cells and squamous epithelium

rabbit anti-CD138 monoclonal antibody (ZR251) 6061

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD138
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil
Visualization: Cell membrane/cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6061parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD138, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD138 monoclonal antibody ZR251 6061

antibody
Database link: human P18827
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil
Immunogen Recombinant fragment (around aa1-250) of human CD138 protein (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens SDC1 Syndecan-1
Protein names Syndecan-1
Gene names SDC1
Protein family Belongs to the syndecan proteoglycan family
Function Cell surface proteoglycan that contains both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix (By similarity). Regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413). Able to induce its own expression in dental mesenchymal cells and also in the neighboring dental epithelial cells via an MSX1-mediated pathway (By similarity)
Subcellular location Membrane, Secreted, Secreted, extracellular exosome
Structure Interacts with CDCP1. Interacts (via C-terminus) with TIAM1 (via PDZ domain). Interacts with MDK (By similarity)
Post-translational modification Shedding is enhanced by a number of factors such as heparanase, thrombin or EGF. Also by stress and wound healing. PMA-mediated shedding is inhibited by TIMP3
Keywords 3D-structure, Glycoprotein, Heparan sulfate, Membrane, Phosphoprotein, Proteoglycan, Proteomics identification, Reference proteome, Secreted, Signal, Transmembrane, Transmembrane helix
Sequence MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ KPTKQEEFYA
UniProt accession: P18827

Data

Formalin-fixed, paraffin-embedded human tonsil stained with anti-CD138 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of plasma cells and squamous epithelium

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-CD138 monoclonal antibody (ZR251) specifically react with?

This antibody specifically reacts with human CD138 protein.

How should the rabbit anti-CD138 monoclonal antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, avoiding repeated freeze/thaw cycles.

What is the recommended dilution range for using the concentrated rabbit anti-CD138 monoclonal antibody in immunohistochemistry (IHC)?

The recommended dilution for the concentrated antibody in IHC applications is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.