Immunohistochemistry (IHC) : Formalin-Fixed, paraffin-embedded human colon carcinoma stained with anti-CD103 antibody using peroxidase-conjugate and DAB chromogen. Note the cell surface staining of subset of T cells

rabbit anti-CD103 monoclonal antibody (ZR404) 6054

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD103
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: colon
Visualization: Cell surface and cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6054parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD103, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD103 monoclonal antibody ZR404 6054

antibody
Database link: human P38570
Tested applications IHC
Recommended dilutions As directed
Application Notes Positive control: colon
Immunogen Recombinant human ITGAE/CD103 protein fragment (aa 775-855)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens ITGAE Integrin alpha-E
Protein names Integrin alpha-E
Alternative names HML-1 antigen, Integrin alpha-IEL, Mucosal lymphocyte 1 antigen
Gene names ITGAE
Protein family Belongs to the integrin alpha chain family
Function Integrin ITGAE/ITGB7 (alpha-E/beta-7) is a receptor for E-cadherin. It mediates adhesion of intra-epithelial T-lymphocytes to epithelial cell monolayers
Subcellular location Membrane
Structure Heterodimer of an alpha and a beta subunit (PubMed:1542691, PubMed:38781659). ITGAE/alpha-E associates with ITGB7/beta-7 (PubMed:1542691, PubMed:38781659). In the absence of the E-cadherin ligand, the heterodimer shows an overall half-bent conformation, an intermediate between closed and open conformations, with the alpha-I domain of ITGAE/alpha-E, which is responsible for ligand binding, covering the headpiece domain (PubMed:38781659)
Keywords 3D-structure, Calcium, Cell adhesion, Direct protein sequencing, Disulfide bond, Glycoprotein, Integrin, Membrane, Metal-binding, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSS ELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRAL EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR RKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTARELNLIASD PDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGA PRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYH VHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP LEGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL ADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGL REALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGELCEEDCF SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVA SVLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQ FRHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVA VKKLTRTQASTVCTWSQERACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISWDHSEEL LKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHSLPIIIKGSVGGLLVLI VILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEEN
UniProt accession: P38570

Data

Formalin-Fixed, paraffin-embedded human colon carcinoma stained with anti-CD103 antibody using peroxidase-conjugate and DAB chromogen. Note the cell surface staining of subset of T cells

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-CD103 monoclonal antibody (ZR404) validated for?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

What species does the rabbit anti-CD103 monoclonal antibody (ZR404) specifically react with?

The antibody is reactive with human samples only.

How should the rabbit anti-CD103 monoclonal antibody (ZR404) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term storage, store at -20°C and avoid repeated freeze/thaw cycles.

What is the immunogen used to generate the rabbit anti-CD103 monoclonal antibody (ZR404)?

The immunogen is a recombinant human ITGAE/CD103 protein fragment spanning amino acids 775 to 855.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.