Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human colon adenocarcinoma stained with anti-c-myc antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

rabbit anti-c-myc monoclonal antibody (ZR355) 6040

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to c-myc
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Burkitt lymphoma
Visualization: Cytoplasmic and nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6040parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, c-myc, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-c-myc monoclonal antibody ZR355 6040

antibody
Database link: human P01106
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Burkitt lymphoma
Immunogen Recombinant fragment of human MYC protein (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens MYC Myc proto-oncogene protein
Protein names Myc proto-oncogene protein
Alternative names Class E basic helix-loop-helix protein 39, Proto-oncogene c-Myc, Transcription factor p64
Gene names MYC
Function Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3' (PubMed:24940000, PubMed:25956029). Activates the transcription of growth-related genes (PubMed:24940000, PubMed:25956029). Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis (PubMed:24940000, PubMed:25956029). Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells (By similarity). Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity). Positively regulates transcription of HNRNPA1, HNRNPA2 and PTBP1 which in turn regulate splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform (PubMed:20010808)
Subcellular location Nucleus, nucleoplasm, Nucleus, nucleolus, Nucleus, Cytoplasm, Chromosome
Structure Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX (PubMed:9680483). Interacts with TAF1C and SPAG9. Interacts with PARP10. Interacts with KDM5A and KDM5B. Interacts (when phosphorylated at Thr-73 and Ser-77) with FBXW7 (PubMed:17558397, PubMed:25775507). Interacts with PIM2. Interacts with RIOX1. The heterodimer MYC:MAX interacts with ABI1; the interaction may enhance MYC:MAX transcriptional activity. Interacts with TRIM6 (By similarity). Interacts with NPM1; the binary complex is recruited to the promoter of MYC target genes and enhances their transcription (PubMed:25956029). Interacts with CIP2A; leading to the stabilization of MYC (PubMed:17632056). Interacts with NUP205 (PubMed:22719065). Interacts with HEATR1; the interaction is required for localization of MYC to the nucleolus (PubMed:38225354)
Post-translational modification Phosphorylated by PRKDC (PubMed:1597196). Phosphorylation at Ser-344 by PIM2 leads to the stabilization of MYC (By similarity). Phosphorylation at Ser-77 by CDK2 prevents Ras-induced senescence (PubMed:19966300, PubMed:20713526). Phosphorylated at Ser-77 by DYRK2; this primes the protein for subsequent phosphorylation by GSK3B at Thr-73 (PubMed:22307329). Phosphorylation at Thr-73 and Ser-77 by GSK3 is required for ubiquitination and degradation by the proteasome (PubMed:15103331, PubMed:17558397, PubMed:8386367). Dephosphorylation at multiple sites by the PNUTS-PP1 complex promotes MYC stability by preventing ubiquitination by the SCF(FBXW7) complex (PubMed:30158517). Dephosphorylation at Ser-77 by protein phosphatase 2A (PPP2CA) promotes its degradation; interaction with PPP2CA is enhanced by AMBRA1 (PubMed:25438055, PubMed:25803737) Ubiquitinated by the SCF(FBXW7) complex when phosphorylated at Thr-73 and Ser-77, leading to its degradation by the proteasome (PubMed:15103331, PubMed:17558397, PubMed:25775507, PubMed:30158517). In the nucleoplasm, ubiquitination is counteracted by USP28, which interacts with isoform 1 of FBXW7 (FBW7alpha), leading to its deubiquitination and preventing degradation (PubMed:17558397, PubMed:17873522). In the nucleolus, however, ubiquitination is not counteracted by USP28 but by USP36, due to the lack of interaction between isoform 3 of FBXW7 (FBW7gamma) and USP28, explaining the selective MYC degradation in the nucleolus (PubMed:17558397, PubMed:25775507). Also polyubiquitinated by the DCX(TRPC4AP) complex (PubMed:20551172, PubMed:29779948). Ubiquitinated by UBR5 when not forming a heterodimer with another bHLH protein, leading to its degradation: UBR5 recognizes and binds a degron that is only available upon heterodimer dissociation (PubMed:33208877, PubMed:37478862). Ubiquitinated by TRIM6 in a phosphorylation-independent manner (By similarity)
Involvement in disease Burkitt lymphoma A form of undifferentiated malignant lymphoma commonly manifested as a large osteolytic lesion in the jaw or as an abdominal mass.
Keywords 3D-structure, Acetylation, Activator, Alternative initiation, Alternative splicing, Chromosomal rearrangement, Chromosome, Cytoplasm, DNA-binding, Glycoprotein, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Proto-oncogene, Reference proteome, Transcription, Transcription regulation, Ubl conjugation
Sequence MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
UniProt accession: P01106

Data

Formalin-fixed, paraffin-embedded human colon adenocarcinoma stained with anti-c-myc antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-c-myc monoclonal antibody (ZR355) specifically react with?

This antibody specifically reacts with human samples.

For which application is the rabbit anti-c-myc monoclonal antibody (ZR355) validated and recommended?

It is validated and recommended for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-c-myc monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C; for long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided.

What are the available sizes and concentrations of the rabbit anti-c-myc monoclonal antibody (ZR355)?

The antibody is available in concentrated forms of 0.1 mL, 0.5 mL, and 1.0 mL, as well as a 7 mL prediluted form.

What is the recommended dilution range when using the concentrated rabbit anti-c-myc monoclonal antibody for IHC?

The recommended dilution for the concentrated antibody in IHC applications is between 1:50 and 1:100.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.