Immunohistochemistry (IHC) : Human lymph node stained with anti-OCT-2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of follicular center B cells.

mouse anti-OCT-2 monoclonal antibody (ZM90) 6298

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to OCT-2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: B-cell lymphoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6298parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, OCT-2

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-OCT-2 monoclonal antibody ZM90 6298

antibody
Database link: human P09086
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: B-cell lymphoma
Immunogen Recombinant human OCT2 protein fragment (around aa 112-297)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens POU2F2 POU domain, class 2, transcription factor 2
Protein names POU domain, class 2, transcription factor 2
Alternative names Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2, Octamer-binding protein 2, Octamer-binding transcription factor 2
Gene names POU2F2
Protein family Belongs to the POU transcription factor family. Class-2 subfamily
Function Transcription factor that specifically binds to the octamer motif (5'-ATTTGCAT-3') (PubMed:2904654, PubMed:7859290). Regulates IL6 expression in B cells with POU2AF1 (By similarity). Regulates transcription in a number of tissues in addition to activating immunoglobulin gene expression (PubMed:2901913, PubMed:2904654). Modulates transcription transactivation by NR3C1, AR and PGR (PubMed:10480874)
Subcellular location Cytoplasm, Nucleus
Structure Interacts with NR3C1, AR and PGR (PubMed:10480874). Interacts with POU2AF1; the interaction increases POU2F2 transactivation activity (PubMed:7859290)
Keywords 3D-structure, Activator, Alternative splicing, Cytoplasm, DNA-binding, Homeobox, Nucleus, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPS TKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLS HPQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTT ISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKK RTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSA APMLPSPGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGG GGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
UniProt accession: P09086

Data

Human lymph node stained with anti-OCT-2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of follicular center B cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution for using the mouse anti-OCT-2 monoclonal antibody (ZM90) in immunohistochemistry?

The recommended dilution for the concentrated mouse anti-OCT-2 monoclonal antibody (ZM90) in immunohistochemistry is between 1:100 and 1:200.

How should the mouse anti-OCT-2 monoclonal antibody (ZM90) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.