Immunohistochemistry (IHC) : Human tonsil stained with anti-Granzyme B antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic granular staining of cytotoxic T-cells.

mouse anti-Granzyme B monoclonal antibody (ZM66) 6204

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Granzyme B
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Tonsil
Visualization: Granular cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6204parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Granzyme B, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Granzyme B monoclonal antibody ZM66 6204

antibody
Database link: human P10144
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil
Immunogen Recombinant human GZMB protein fragment (around aa 73-187)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens GZMB Granzyme B
Protein names Granzyme B
Alternative names C11, CTLA-1, Cathepsin G-like 1, Cytotoxic T-lymphocyte proteinase 2, Fragmentin-2, Granzyme-2, Human lymphocyte protein, SECT, T-cell serine protease 1-3E
Gene names GZMB
Protein family Belongs to the peptidase S1 family. Granzyme subfamily
Function Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse (PubMed:1985927, PubMed:3262682, PubMed:3263427). It cleaves after Asp (PubMed:1985927, PubMed:8258716). Once delivered into the target cell, acts by catalyzing cleavage of gasdermin-E (GSDME), releasing the pore-forming moiety of GSDME, thereby triggering pyroptosis and target cell death (PubMed:31953257, PubMed:32188940). Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -9 and -10 (CASP3, CASP9 and CASP10, respectively) to give rise to active enzymes mediating apoptosis (PubMed:9852092). Cleaves and activates CASP7 in response to bacterial infection, promoting plasma membrane repair (By similarity)
Catalytic activity Preferential cleavage: -Asp-\|-Xaa- >> -Asn-\|-Xaa- > -Met-\|-Xaa-, -Ser-\|-Xaa-.
Subcellular location Secreted, Cytolytic granule
Keywords 3D-structure, Apoptosis, Cytolysis, Direct protein sequencing, Disulfide bond, Glycoprotein, Hydrolase, Lysosome, Protease, Proteomics identification, Reference proteome, Secreted, Serine protease, Signal, Zymogen
Sequence MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVL TAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKR TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHY YDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI KKTMKRY
UniProt accession: P10144

Data

Human tonsil stained with anti-Granzyme B antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic granular staining of cytotoxic T-cells.

FAQ & Publications

Frequently Asked Questions

What is the primary application of the Campylobacter jejuni IgG ELISA Kit MD-6204?

The Campylobacter jejuni IgG ELISA Kit MD-6204 is designed for indirect, quantitative detection of IgG antibodies against Campylobacter jejuni in serum, plasma, or whole blood samples using ELISA methodology.

How should the Campylobacter jejuni IgG ELISA Kit MD-6204 be stored to maintain its stability?

The kit components should be stored refrigerated at 2-8°C to ensure proper preservation and performance of the assay reagents.

Which species’ antibodies does the Campylobacter jejuni IgG ELISA Kit MD-6204 specifically detect?

This ELISA kit specifically detects IgG antibodies that are reactive to Campylobacter jejuni, the bacterial species targeted by the assay.

What controls are included in the Campylobacter jejuni IgG ELISA Kit MD-6204 to validate assay performance?

The kit includes positive, cutoff, and negative controls containing preservatives such as MIT and Oxypyrion to ensure assay accuracy and reliability during testing.

What species does the mouse anti-Granzyme B monoclonal antibody (ZM66) 6204 react with?

This antibody is reactive with human Granzyme B protein.

What are the recommended storage conditions for the mouse anti-Granzyme B monoclonal antibody (ZM66) 6204?

Store the antibody at 2-8°C for short term use and at -20°C for long term storage, avoiding freeze/thaw cycles.

For which application is this mouse anti-Granzyme B monoclonal antibody validated, and what is the suggested dilution?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues with a recommended concentrated antibody dilution of 1:100-200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.