Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human solitary fibrous tumor stained with anti-STAT6 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear and cytoplasmic staining of tumor cells

rabbit anti-STAT6 monoclonal antibody (ZR289) 6369

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to STAT6
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Solitary fibrous tumor
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6369parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Soft Tissue Pathology, STAT6

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-STAT6 monoclonal antibody ZR289 6369

antibody
Database link: human P42226
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Solitary fibrous tumor
Immunogen Recombinant full-length human STAT6 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens STAT6 Signal transducer and activator of transcription 6
Protein names Signal transducer and activator of transcription 6
Alternative names IL-4 Stat
Gene names STAT6
Protein family Belongs to the transcription factor STAT family
Function Carries out a dual function: signal transduction and activation of transcription. Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling
Subcellular location Cytoplasm, Nucleus
Structure Forms a homodimer or a heterodimer with a related family member (By similarity). Interacts with NCOA1 via its C-terminal LXXLL motif
Post-translational modification Tyrosine phosphorylated on Tyr-641 following stimulation by IL4/interleukin-4 (PubMed:27796300). Tyrosine phosphorylated following stimulation by IL3/interleukin-3 (By similarity). Dephosphorylation on tyrosine residues by PTPN2 negatively regulates the IL4/interleukin-4 mediated signaling (PubMed:17210636) Mono-ADP-ribosylated by PARP14
Involvement in disease Hyper-IgE syndrome 6, autosomal dominant, with recurrent infections An immunologic disorder characterized by severe allergic disease with onset in infancy. Common features are treatment-resistant atopic dermatitis, food allergies, asthma, eosinophilic gastrointestinal disease, and severe episodes of anaphylaxis. Half of the patients present with recurrent skin, respiratory, and viral infections. Clinical laboratory testing is notable for eosinophilia and markedly elevated serum IgE levels.
Keywords 3D-structure, Acetylation, Activator, ADP-ribosylation, Alternative splicing, Cytoplasm, Disease variant, DNA-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, SH2 domain, Transcription, Transcription regulation
Sequence MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALA MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ EVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE PHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD LRANPSW
UniProt accession: P42226

Data

Formalin-fixed, paraffin-embedded human solitary fibrous tumor stained with anti-STAT6 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear and cytoplasmic staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-STAT6 monoclonal antibody (ZR289) reactive with?

This antibody is reactive with human species.

What are the recommended storage conditions for the rabbit anti-STAT6 monoclonal antibody (ZR289)?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C while avoiding freeze/thaw cycles.

Which applications is the rabbit anti-STAT6 monoclonal antibody (ZR289) validated for, and what is the recommended dilution?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. The recommended dilution for concentrated antibody is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.