Immunohistochemistry (IHC) : Human Ewing’s sarcoma stained with anti-NKX2.2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells.

rabbit anti-NKX2.2 monoclonal antibody (ZR438) 6290

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to NKX2.2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Ewing’s sarcoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6290parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, NKX2.2, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-NKX2.2 monoclonal antibody ZR438 6290

antibody
Database link: human O95096
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Ewing's sarcoma
Immunogen Human recombinant NKX2.2 protein fragment (aa 1-119)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens NKX2-2 Homeobox protein Nkx-2.2
Protein names Homeobox protein Nkx-2.2
Alternative names Homeobox protein NK-2 homolog B
Gene names NKX2-2
Protein family Belongs to the NK-2 homeobox family
Function Transcriptional activator involved in the development of insulin-producting beta cells in the endocrine pancreas (By similarity). May also be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Binds to elements within the NEUROD1 promoter (By similarity)
Subcellular location Nucleus
Structure Interacts with OLIG2
Keywords Activator, Developmental protein, DNA-binding, Homeobox, Nucleus, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLP LKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPG GGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHR YKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQ SLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
UniProt accession: O95096

Data

Human Ewing'ss sarcoma stained with anti-NKX2.2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-NKX2.2 monoclonal antibody (ZR438) specifically react with?

This antibody is reactive with human species only.

For which application is the rabbit anti-NKX2.2 monoclonal antibody (ZR438) validated and recommended?

It is validated and recommended for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended dilution ranges when using the concentrated form of this antibody for IHC?

The recommended dilution for the concentrated antibody is between 1:100 and 1:200 for immunohistochemistry.

How should the rabbit anti-NKX2.2 monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term storage, it should be kept at -20°C and freeze/thaw cycles should be avoided.

What is used as a positive control when performing immunohistochemistry with this NKX2.2 antibody?

Ewing's sarcoma tissue is recommended as the positive control for this antibody in IHC applications.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.