Skip to content

mouse anti-MDM2 monoclonal antibody (SMP14) 6250

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to MDM2
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG1
  • Control: Liposarcoma
  • Visualization: Nuclear
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
SKU: 6250parent Categories: , Tags: , ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-MDM2 monoclonal antibody SMP14 6250

antibody
Database link:
human Q00987
Tested applications
IHC
Recommended dilutions
Concentrated 1:50-100
Application Notes
Positive control: Liposarcoma
Immunogen
Amino acids 154-167 of MDM2 of human origin
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG1 - Isotype Control
target relevance
Homo sapiens MDM2
E3 ubiquitin-protein ligase Mdm2
Protein names
E3 ubiquitin-protein ligase Mdm2
Alternative names
Double minute 2 protein, Oncoprotein Mdm2, RING-type E3 ubiquitin transferase Mdm2, p53-binding protein Mdm2
Gene names
MDM2
Protein family
Belongs to the MDM2/MDM4 family
Function
E3 ubiquitin-protein ligase that mediates ubiquitination of p53/TP53, leading to its degradation by the proteasome (PubMed:29681526). Inhibits p53/TP53- and p73/TP73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Also acts as a ubiquitin ligase E3 toward itself and ARRB1. Permits the nuclear export of p53/TP53. Promotes proteasome-dependent ubiquitin-independent degradation of retinoblastoma RB1 protein. Inhibits DAXX-mediated apoptosis by inducing its ubiquitination and degradation. Component of the TRIM28/KAP1-MDM2-p53/TP53 complex involved in stabilizing p53/TP53. Also a component of the TRIM28/KAP1-ERBB4-MDM2 complex which links growth factor and DNA damage response pathways. Mediates ubiquitination and subsequent proteasome degradation of DYRK2 in nucleus. Ubiquitinates IGF1R and SNAI1 and promotes them to proteasomal degradation (PubMed:12821780, PubMed:15053880, PubMed:15195100, PubMed:15632057, PubMed:16337594, PubMed:17290220, PubMed:19098711, PubMed:19219073, PubMed:19837670, PubMed:19965871, PubMed:20173098, PubMed:20385133, PubMed:20858735, PubMed:22128911). Ubiquitinates DCX, leading to DCX degradation and reduction of the dendritic spine density of olfactory bulb granule cells (By similarity). Ubiquitinates DLG4, leading to proteasomal degradation of DLG4 which is required for AMPA receptor endocytosis (By similarity). Negatively regulates NDUFS1, leading to decreased mitochondrial respiration, marked oxidative stress, and commitment to the mitochondrial pathway of apoptosis (PubMed:30879903). Binds NDUFS1 leading to its cytosolic retention rather than mitochondrial localization resulting in decreased supercomplex assembly (interactions between complex I and complex III), decreased complex I activity, ROS production, and apoptosis (PubMed:30879903)
Catalytic activity
S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
Subcellular location
Nucleus, nucleoplasm, Cytoplasm, Nucleus, nucleolus, Nucleus
Structure
(Microbial infection) Interacts with and ubiquitinates HIV-1 Tat
Post-translational modification
Phosphorylation on Ser-166 by SGK1 activates ubiquitination of p53/TP53 (PubMed:19756449). Phosphorylated at multiple sites near the RING domain by ATM upon DNA damage; this promotes its ubiquitination and degradation, preventing p53/TP53 degradation (PubMed:10611322, PubMed:12167711, PubMed:18382127, PubMed:19816404, PubMed:26124108)
Autoubiquitination leads to proteasomal degradation; resulting in p53/TP53 activation it may be regulated by SFN (PubMed:18382127, PubMed:30879903). Also ubiquitinated by TRIM13 (PubMed:21333377). ATM-phosphorylated MDM2 is ubiquitinated by the SCF(FBXO31) complex in response to genotoxic stress, promoting its degradation and p53/TP53-mediated DNA damage response (PubMed:26124108). Deubiquitinated by USP2 leads to its accumulation and increases deubiquitination and degradation of p53/TP53 (PubMed:17290220). Deubiquitinated by USP7 leading to its stabilization (PubMed:15053880)
Involvement in disease
Lessel-Kubisch syndrome
An autosomal recessive progeroid syndrome characterized by short stature, pinched facial features, prematurely gray hair, scleroderma-like skin changes, small kidneys and consecutive kidney failure, followed by severe arterial hypertension.

Keywords
3D-structure, Alternative splicing, Apoptosis, Cytoplasm, Host-virus interaction, Metal-binding, Nucleus, Phosphoprotein, Proteomics identification, Proto-oncogene, Reference proteome, Transferase, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger
Sequence
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ PIQMIVLTYFP
UniProt accession: Q00987

Data

Human atypical lipomatous tumor stained with anti-MDM2 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.
Human atypical lipomatous tumor stained with anti-MDM2 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions
What applications is the mouse anti-MDM2 monoclonal antibody (SMP14) validated for?
This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples.
What species does the mouse anti-MDM2 monoclonal antibody (SMP14) specifically react with?
The antibody specifically reacts with human MDM2 protein.
How should the mouse anti-MDM2 monoclonal antibody (SMP14) be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, store at -20°C and avoid repeated freeze-thaw cycles.
What is the recommended dilution range for using the concentrated mouse anti-MDM2 monoclonal antibody (SMP14) in IHC?
The recommended dilution range for the concentrated antibody in immunohistochemistry is 1:50 to 1:100.
What is the host species and isotype of the anti-MDM2 monoclonal antibody SMP14?
The antibody is a mouse monoclonal of the IgG1 isotype.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.