Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human skeletal muscle stained with anti-myoglobin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of skeletal muscle fibers.

rabbit anti-Myoglobin monoclonal antibody (ZR69) 6280

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Myoglobin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Skeletal muscle
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6280parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, Myoglobin, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Myoglobin monoclonal antibody ZR69 6280

antibody
Database link: human P02144
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Skeletal muscle
Immunogen Recombinant human full-length Myoglobin (MB) protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens MB Myoglobin
Protein names Myoglobin
Alternative names Nitrite reductase MB, Pseudoperoxidase MB
Gene names MB
Protein family Belongs to the globin family
Function Monomeric heme protein which primary function is to store oxygen and facilitate its diffusion within muscle tissues. Reversibly binds oxygen through a pentacoordinated heme iron and enables its timely and efficient release as needed during periods of heightened demand (PubMed:30918256, PubMed:34679218). Depending on the oxidative conditions of tissues and cells, and in addition to its ability to bind oxygen, it also has a nitrite reductase activity whereby it regulates the production of bioactive nitric oxide (PubMed:32891753). Under stress conditions, like hypoxia and anoxia, it also protects cells against reactive oxygen species thanks to its pseudoperoxidase activity (PubMed:34679218)
Catalytic activity Fe(III)-heme b-[protein] + nitric oxide + H2O = Fe(II)-heme b-[protein] + nitrite + 2 H(+) H2O2 + AH2 = A + 2 H2O
Subcellular location Cytoplasm, sarcoplasm
Structure Monomeric
Involvement in disease Myopathy, sarcoplasmic body An autosomal dominant, slowly progressive muscle disorder manifesting in adulthood with proximal and axial weakness that progresses to involve distal muscles. Patients may lose ambulation after a long disease course, and some individuals develop respiratory or cardiac symptoms. Muscle pathology features include sarcoplasmic bodies in skeletal and cardiac muscles.
Keywords 3D-structure, Cytoplasm, Direct protein sequencing, Disease variant, Heme, Iron, Metal-binding, Muscle protein, Oxidoreductase, Oxygen transport, Phosphoprotein, Proteomics identification, Reference proteome, Transport
Sequence MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH PGDFGADAQGAMNKALELFRKDMASNYKELGFQG
UniProt accession: P02144

Data

Formalin-fixed, paraffin-embedded human skeletal muscle stained with anti-myoglobin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of skeletal muscle fibers.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Myoglobin monoclonal antibody (ZR69) specifically react with?

This antibody specifically reacts with human Myoglobin.

What are the recommended storage conditions for maintaining the stability of this antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to maintain antibody integrity.

Which applications has the rabbit anti-Myoglobin monoclonal antibody (ZR69) been validated for, and what is a suitable positive control?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. Skeletal muscle is recommended as a positive control for this application.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.