Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human lymph node stained with anti-OCT2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of follicular B cells

rabbit anti-OCT-2 monoclonal antibody (ZR227) 6297

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to OCT-2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: B-cell lymphoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6297parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, monoclonal, OCT-2

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-OCT-2 monoclonal antibody ZR227 6297

antibody
Database link: human P09086
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: B-cell lymphoma
Immunogen Recombinant human OCT2 protein fragment (around aa 112-297)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens POU2F2 POU domain, class 2, transcription factor 2
Protein names POU domain, class 2, transcription factor 2
Alternative names Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2, Octamer-binding protein 2, Octamer-binding transcription factor 2
Gene names POU2F2
Protein family Belongs to the POU transcription factor family. Class-2 subfamily
Function Transcription factor that specifically binds to the octamer motif (5'-ATTTGCAT-3') (PubMed:2904654, PubMed:7859290). Regulates IL6 expression in B cells with POU2AF1 (By similarity). Regulates transcription in a number of tissues in addition to activating immunoglobulin gene expression (PubMed:2901913, PubMed:2904654). Modulates transcription transactivation by NR3C1, AR and PGR (PubMed:10480874)
Subcellular location Cytoplasm, Nucleus
Structure Interacts with NR3C1, AR and PGR (PubMed:10480874). Interacts with POU2AF1; the interaction increases POU2F2 transactivation activity (PubMed:7859290)
Keywords 3D-structure, Activator, Alternative splicing, Cytoplasm, DNA-binding, Homeobox, Nucleus, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPS TKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLS HPQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTT ISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKK RTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSA APMLPSPGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGG GGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
UniProt accession: P09086

Data

Formalin-fixed, paraffin-embedded human lymph node stained with anti-OCT2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of follicular B cells

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-OCT-2 monoclonal antibody (ZR227) validated for?

This antibody is suitable for immunohistochemistry (IHC) applications, specifically in formalin-fixed, paraffin-embedded tissues.

Which species does the rabbit anti-OCT-2 monoclonal antibody (ZR227) react with?

The antibody is reactive with human tissues.

How should the rabbit anti-OCT-2 monoclonal antibody (ZR227) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, avoiding freeze-thaw cycles.

What is the recommended dilution for using the concentrated form of this OCT-2 antibody in IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.