Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human IgA myeloma stained with anti-MUM1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining in tumor cells

rabbit anti-MUM1 monoclonal antibody (ZR411) 7273

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to MUM1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil or myeloma
Visualization: Nucleus
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 7273parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, monoclonal, MUM1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-MUM1 monoclonal antibody ZR411 7273

antibody
Database link: human Q15306
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil or myeloma
Immunogen Recombinant fragment (corresponding to C-terminal) of IRF4 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens IRF4 Interferon regulatory factor 4
Protein names Interferon regulatory factor 4
Alternative names Lymphocyte-specific interferon regulatory factor, Multiple myeloma oncogene 1, NF-EM5
Gene names IRF4
Protein family Belongs to the IRF family
Function Transcriptional activator. Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter. Binds the immunoglobulin lambda light chain enhancer, together with PU.1. Probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF4 and activation of genes
Subcellular location Nucleus, Cytoplasm
Structure Interacts with the BATF-JUNB heterodimer. Interacts with BATF (via bZIP domain); the interaction is direct (By similarity). Interacts with SPIB (PubMed:10196196). Interacts with DEF6 (PubMed:12651066). Directly interacts with NLRP3 in the nucleus of Th2 cells; this interaction enhances IRF4 ability to bind to the IL4 promoter and is required for optimal IRF4-dependent IL4 transcription (By similarity). Interacts with SPI1 (PubMed:33951726)
Post-translational modification Phosphorylation by ROCK2 regulates IL-17 and IL-21 production
Involvement in disease Multiple myeloma A malignant tumor of plasma cells usually arising in the bone marrow and characterized by diffuse involvement of the skeletal system, hyperglobulinemia, Bence-Jones proteinuria and anemia. Complications of multiple myeloma are bone pain, hypercalcemia, renal failure and spinal cord compression. The aberrant antibodies that are produced lead to impaired humoral immunity and patients have a high prevalence of infection. Amyloidosis may develop in some patients. Multiple myeloma is part of a spectrum of diseases ranging from monoclonal gammopathy of unknown significance (MGUS) to plasma cell leukemia. Immunodeficiency 131 An immunologic disorder characterized by recurrent infections, including infections with opportunistic pathogens, and low IgM, IgG, and IgA serum levels, low plasma cell counts and abnormal T-cell subsets. IMD131 inheritance can be autosomal dominant or autosomal recessive.
Keywords 3D-structure, Activator, Alternative splicing, Chromosomal rearrangement, Cytoplasm, Disease variant, DNA-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQ DYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISD PYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRD YVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIR SAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQ RKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFD TQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN SGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
UniProt accession: Q15306

Data

Formalin-fixed, paraffin-embedded human IgA myeloma stained with anti-MUM1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining in tumor cells

FAQ & Publications

Frequently Asked Questions

What is the recommended application and dilution for the rabbit anti-MUM1 monoclonal antibody (ZR411) 7273?

The rabbit anti-MUM1 monoclonal antibody (ZR411) 7273 is recommended for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. For concentrated antibody, the suggested dilution range is 1:100 to 1:200.

How should the rabbit anti-MUM1 monoclonal antibody (ZR411) 7273 be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.