Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded prostate adenocarcinoma stained with anti-NKX3.1 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells

rabbit anti-NKX3.1 monoclonal antibody (ZR222) 6292

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to NKX3.1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Prostate
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6292parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, NKX3.1, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-NKX3.1 monoclonal antibody ZR222 6292

antibody
Database link: human Q99801
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Prostate
Immunogen Recombinant fragment (around aa 92-224) of human NKX3.1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens NKX3-1 Homeobox protein Nkx-3.1
Protein names Homeobox protein Nkx-3.1
Alternative names Homeobox protein NK-3 homolog A
Gene names NKX3-1
Protein family Belongs to the NK-3 homeobox family
Function Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Acts as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells
Subcellular location Nucleus
Structure Interacts with serum response factor (SRF) (By similarity). Interacts with SPDEF (PubMed:11809674). Interacts with WDR77 (PubMed:12972618). Interacts with TOPORS which polyubiquitinates NKX3-1 and induces its proteasomal degradation (PubMed:18077445). Interacts with FEM1B (By similarity)
Post-translational modification Ubiquitinated by TOPORS; monoubiquitinated at several residues and also polyubiquitinated on single residues
Keywords 3D-structure, Alternative splicing, DNA-binding, Homeobox, Nucleus, Proteomics identification, Reference proteome, Repressor, Transcription, Transcription regulation, Tumor suppressor, Ubl conjugation
Sequence MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEP EPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTP KQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTK RKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW
UniProt accession: Q99801

Data

Formalin-fixed, paraffin-embedded prostate adenocarcinoma stained with anti-NKX3.1 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-NKX3.1 monoclonal antibody (ZR222) specifically react with?

This antibody specifically reacts with human tissues.

Which applications is the rabbit anti-NKX3.1 monoclonal antibody (ZR222) validated for?

It is validated for use in Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for the rabbit anti-NKX3.1 monoclonal antibody (ZR222)?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, keep it at -20°C and avoid freeze/thaw cycles.

What are the available sizes and concentrations for this antibody?

The antibody is available as 0.1 mL, 0.5 mL, and 1.0 mL in concentrated form, and a 7 mL prediluted format.

What is the host species and clonality of the anti-NKX3.1 antibody (ZR222)?

The antibody is a monoclonal antibody produced in rabbit.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.