| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
rabbit anti-CD8 monoclonal antibody (ZR286) 6115
Price range: $160.00 through $528.00
Antibody summary
- Rabbit monoclonal to CD8
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG
- Control: Lymph node
- Visualization: Cell membrane
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
rabbit anti-CD8 monoclonal antibody ZR286 6115
| target relevance |
|---|
| Protein names T-cell surface glycoprotein CD8 alpha chain (T-lymphocyte differentiation antigen T8/Leu-2) (CD antigen CD8a) |
| Gene names CD8A,CD8A MAL |
| Mass 25729Da |
| Catalytic activity CD8A MAL |
| Pathway 9606 |
| Subellular location CD8A MAL |
| Domain MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV |
| Target Relevance information above includes information from UniProt accession: P01732 |
| The UniProt Consortium |
Data
![]() |
| Human tonsil stained with anti-CD8 antibody using peroxidase-conjugate and DAB chromogen. Not the membrane staining of perifollicular T-cells. |
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| # | SDS | Certificate | |
|---|---|---|---|
| Please enter your product and batch number here to retrieve product datasheet, SDS, and QC information. | |||
Only logged in customers who have purchased this product may leave a review.
















Reviews
There are no reviews yet.