Immunohistochemistry (IHC) : Formalin-fixed paraffin-embedded human tonsil stained with anti-CD7antibody using peroxidase-conjugate and DAB chromogen. Note cell membrane staining of perifollicular T-cells cell

rabbit anti-CD7 monoclonal antibody (ZR416) 6109

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD7
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil or lymph node
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6109parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD7, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD7 monoclonal antibody ZR416 6109

antibody
Database link: human P09564
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil or lymph node
Immunogen Recombinant fragment (around aa 72-175) of human CD7 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CD7 T-cell antigen CD7
Protein names T-cell antigen CD7
Alternative names GP40, T-cell leukemia antigen, T-cell surface antigen Leu-9, TP41
Gene names CD7
Function Transmembrane glycoprotein expressed by T-cells and natural killer (NK) cells and their precursors (PubMed:7506726). Plays a costimulatory role in T-cell activation upon binding to its ligand K12/SECTM1 (PubMed:10652336). In turn, mediates the production of cytokines such as IL-2 (PubMed:1709867). On resting NK-cells, CD7 activation results in a significant induction of interferon-gamma levels (PubMed:7506726)
Subcellular location Membrane
Structure Interacts with SECTM1
Keywords Adaptive immunity, Disulfide bond, Glycoprotein, Immunity, Immunoglobulin domain, Lipoprotein, Membrane, Palmitate, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEV NVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
UniProt accession: P09564

Data

Formalin-fixed paraffin-embedded human tonsil stained with anti-CD7antibody using peroxidase-conjugate and DAB chromogen. Note cell membrane staining of perifollicular T-cells cell

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-CD7 monoclonal antibody (ZR416) validated for?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

How should the rabbit anti-CD7 monoclonal antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C; for long-term storage, it should be kept at -20°C while avoiding repeated freeze/thaw cycles.

Is the rabbit anti-CD7 antibody reactive with species other than human?

This antibody specifically reacts with human CD7 and is not indicated for other species.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.