Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human colon stained with anti-CD68 antibody using peroxidase conjugate and DAB chromogen. Note intense cytoplasmic staining of macrophages

rabbit anti-CD68 monoclonal antibody (ZR302) 6422

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD68
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil, lymph node, spleen
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6422parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD68, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD68 monoclonal antibody ZR302 6422

antibody
Database link: human P34810
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Tonsil, lymph node, spleen
Immunogen Subcellular fraction of human alveolar macrophages
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CD68 Macrosialin
Protein names Macrosialin
Alternative names Gp110
Gene names CD68
Protein family Belongs to the LAMP family
Function Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells
Subcellular location Endosome membrane, Lysosome membrane
Post-translational modification N- and O-glycosylated
Keywords Alternative splicing, Cell membrane, Disulfide bond, Endosome, Glycoprotein, Lysosome, Membrane, Proteomics identification, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTT THRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNAT VHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRV MYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSY MAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAA QLPHTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSAYQAL
UniProt accession: P34810

Data

Formalin-fixed, paraffin-embedded human colon stained with anti-CD68 antibody using peroxidase conjugate and DAB chromogen. Note intense cytoplasmic staining of macrophages

FAQ & Publications

Frequently Asked Questions

What species does the Rabbit anti-CD68 monoclonal antibody (ZR302) specifically react with?

This antibody is reactive with human species.

For which applications is the Rabbit anti-CD68 monoclonal antibody (ZR302) recommended?

It is suitable for Immunohistochemistry (IHC) applications, specifically on formalin-fixed, paraffin-embedded tissues.

How should the Rabbit anti-CD68 monoclonal antibody (ZR302) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C and freeze/thaw cycles should be avoided.

What is the host species and clonality of the Rabbit anti-CD68 monoclonal antibody (ZR302)?

The antibody is produced in rabbit and is monoclonal in nature.

What is the recommended dilution for using the concentrated Rabbit anti-CD68 monoclonal antibody (ZR302) in IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.