Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human tonsil stained with anti-CD23 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of follicular dendritic cells

rabbit anti-CD23 monoclonal antibody (ZR225) 6078

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD23
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6078parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD23, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD23 monoclonal antibody ZR225 6078

antibody
Database link: human P06734
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil
Immunogen Recombinant fragment (around aa 200-300) of human FCER2/CD23 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens FCER2 Low affinity immunoglobulin epsilon Fc receptor
Protein names Low affinity immunoglobulin epsilon Fc receptor
Alternative names BLAST-2, C-type lectin domain family 4 member J, Fc-epsilon-RII, Immunoglobulin E-binding factor, Lymphocyte IgE receptor
Gene names FCER2
Function Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B cells. On B cells, initiates IgE-dependent antigen uptake and presentation to T cells (PubMed:2167225). On macrophages, upon IgE binding and antigen cross-linking induces intracellular killing of parasites through activation of L-Arginine-nitric oxide pathway (PubMed:7544003)
Subcellular location Cell membrane, Cell membrane, Secreted
Structure Homotrimer. Interacts (via C-type lectin domain) with IGHE (via CH3 region); this interaction regulates IgE homeostasis. Interacts (via the C-terminus) with CR2/CD21 (via Sushi domain 1 and 2) (PubMed:1386409, PubMed:16172256)
Post-translational modification N- and O-glycosylated The secreted form sCD23 is produced by ADAM10-mediated ectodomain shedding
Keywords 3D-structure, Calcium, Cell membrane, Direct protein sequencing, Disulfide bond, Glycoprotein, IgE-binding protein, Lectin, Lipoprotein, Membrane, Metal-binding, Palmitate, Proteoglycan, Proteomics identification, Receptor, Reference proteome, Repeat, Secreted, Signal-anchor, Transmembrane, Transmembrane helix
Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM GPDSRPDPDGRLPTPSAPLHS
UniProt accession: P06734

Data

Formalin-fixed, paraffin-embedded human tonsil stained with anti-CD23 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of follicular dendritic cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-CD23 monoclonal antibody (ZR225) specifically react with?

This antibody specifically reacts with human CD23 protein.

For which application is the rabbit anti-CD23 monoclonal antibody (ZR225) validated and recommended?

It is validated and suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this rabbit anti-CD23 antibody?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, keep it at -20°C while avoiding freeze/thaw cycles.

What is the host species and clonality of the anti-CD23 antibody ZR225?

The antibody is a rabbit monoclonal antibody of the IgG isotype.

What is the immunogen used to generate the rabbit anti-CD23 monoclonal antibody (ZR225)?

The immunogen is a recombinant fragment of the human FCER2/CD23 protein, approximately amino acids 200-300.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.