Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human lymph node stained with anti-CD20 antibody using peroxidase-conjugate and DAB chromogen. Note cell surface staining of B-cells.

rabbit anti-CD20 monoclonal antibody (ZR243) 7072

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD20
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tonsil, lymph node
Visualization: Cell membrane/cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 7072parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD20, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD20 monoclonal antibody ZR243 7072

antibody
Database link: human P11836
Tested applications IHC
Recommended dilutions As directed
Application Notes Positive control: Tonsil, lymph node
Immunogen Recombinant fragment (around aa 197-297) of human MS4A1 protein (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens MS4A1 B-lymphocyte antigen CD20
Protein names B-lymphocyte antigen CD20
Alternative names B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1
Gene names MS4A1
Protein family Belongs to the MS4A family
Function B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes (PubMed:12920111, PubMed:3925015, PubMed:7684739). Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR (PubMed:12920111, PubMed:18474602, PubMed:7684739)
Subcellular location Cell membrane, Cell membrane
Structure Forms homotetramers (PubMed:18474602, PubMed:7684739). Interacts with the heavy and light chains of cell surface IgM, the antigen-binding components of the BCR (PubMed:18474602)
Post-translational modification Phosphorylated on serines and threonines in resting B-cells. Protein kinase C/PKC can use CD20 as substrate
Involvement in disease Immunodeficiency, common variable, 5 A primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low.
Keywords 3D-structure, Alternative splicing, B-cell activation, Cell membrane, Disulfide bond, Lipoprotein, Membrane, Palmitate, Pharmaceutical, Phosphoprotein, Proteomics identification, Reference proteome, Transmembrane, Transmembrane helix
Sequence MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
UniProt accession: P11836

Data

Formalin-fixed, paraffin-embedded human lymph node stained with anti-CD20 antibody using peroxidase-conjugate and DAB chromogen. Note cell surface staining of B-cells.

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-CD20 monoclonal antibody (ZR243) reactive with?

This antibody is reactive with human species only.

Which applications is this rabbit anti-CD20 monoclonal antibody validated for?

The antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for the rabbit anti-CD20 monoclonal antibody (ZR243)?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, and freeze/thaw cycles should be avoided.

What is the host species and clonality of this anti-CD20 antibody?

The antibody is a rabbit monoclonal IgG.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.