Immunohistochemistry (IHC) : Human tonsil stained with anti-CD19 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of B-cells .

rabbit anti-CD19 monoclonal antibody (ZR212) 6067

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD19
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Lymph node or tonsil
Visualization: Membranous
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6067parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD19, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD19 monoclonal antibody ZR212 6067

antibody
Database link: human P15391
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Lymph node or tonsil
Immunogen Recombinant fragment of human CD19 protein (around aa 96-281)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CD19 B-lymphocyte antigen CD19
Protein names B-lymphocyte antigen CD19
Alternative names B-lymphocyte surface antigen B4, Differentiation antigen CD19, T-cell surface antigen Leu-12
Gene names CD19
Function Functions as a coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes (PubMed:29523808). Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens (PubMed:1373518, PubMed:16672701, PubMed:2463100). Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores (PubMed:12387743, PubMed:16672701, PubMed:9317126, PubMed:9382888). Is not required for early steps during B cell differentiation in the blood marrow (PubMed:9317126). Required for normal differentiation of B-1 cells (By similarity). Required for normal B cell differentiation and proliferation in response to antigen challenges (PubMed:1373518, PubMed:2463100). Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge (PubMed:12387743, PubMed:16672701, PubMed:9317126)
Subcellular location Cell membrane, Membrane raft
Structure Interacts with CR2/CD21 (PubMed:1702139). Part of a complex composed of CD19, CR2/CD21, CD81 and IFITM1/CD225 in the membrane of mature B-cells (PubMed:1383329). Interacts directly with CD81 (via the second extracellular domain); this interaction is initiated early during biosynthesis in the ER/pre-Golgi compartments and is essential for trafficking and compartmentalization of CD19 receptor on the cell surface of activated B cells (PubMed:16449649). Interacts with VAV (PubMed:10706702). Interacts with GRB2 and SOS when phosphorylated on Tyr-348 and/or Tyr-378. Interacts with PLCG2 when phosphorylated on Tyr-409 (PubMed:10706702). Interacts with LYN (PubMed:7687428). Interacts (when tyrosine phosphorylated) with the regulatory p85 subunit of phosphatidylinositol 3-kinase (PIK3R1 or PIK3R2) (PubMed:7684160). Interacts with GRB2 (PubMed:29523808)
Post-translational modification Phosphorylated on tyrosine following B-cell activation (PubMed:10706702, PubMed:12387743, PubMed:7684160, PubMed:7687539). Phosphorylated on tyrosine residues by LYN (PubMed:7687428). Tyrosine residues are phosphorylated sequentially after activation of the B cell receptor. Phosphorylation of Tyr-531 is extremely rapid, followed by phosphorylation at Tyr-409. In contrast, phosphorylation of Tyr-500 appears more slowly and is more transient, returning rapidly to basal levels (By similarity)
Involvement in disease Immunodeficiency, common variable, 3 A primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low.
Keywords 3D-structure, Adaptive immunity, Alternative splicing, Cell membrane, Disulfide bond, Glycoprotein, Immunity, Immunoglobulin domain, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP DPAWGGGGRMGTWSTR
UniProt accession: P15391

Data

Human tonsil stained with anti-CD19 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of B-cells .

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-CD19 monoclonal antibody (ZR212) 6067 specifically react with?

This antibody specifically reacts with human CD19 protein.

For which applications is the rabbit anti-CD19 monoclonal antibody (ZR212) 6067 validated?

It is validated for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-CD19 monoclonal antibody (ZR212) 6067 be stored to ensure stability?

The antibody should be stored at 2-8°C for short-term use or at -20°C for long-term storage, avoiding freeze/thaw cycles.

What are the available sizes and concentrations for the rabbit anti-CD19 monoclonal antibody (ZR212) 6067?

It is available in concentrated forms of 0.1 mL, 0.5 mL, and 1.0 mL, as well as a 7 mL prediluted liquid form.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.