Immunohistochemistry (IHC) : Human spleen involved by hairy cell leukemia stained with anti-TRAcP antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of leukemia cells.

mouse anti-TRAcP monoclonal antibody (ZM174) 6391

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to TRAcP
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Hairy cell leukemia
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6391parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, TRAcP

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-TRAcP monoclonal antibody ZM174 6391

antibody
Database link: human P13686
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Hairy cell leukemia
Immunogen Recombinant full-length human ACP5 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens ACP5 Tartrate-resistant acid phosphatase type 5
Protein names Tartrate-resistant acid phosphatase type 5
Alternative names Tartrate-resistant acid ATPase, Type 5 acid phosphatase
Gene names ACP5
Protein family Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family
Function Involved in osteopontin/bone sialoprotein dephosphorylation. Its expression seems to increase in certain pathological states such as Gaucher and Hodgkin diseases, the hairy cell, the B-cell, and the T-cell leukemias
Catalytic activity a phosphate monoester + H2O = an alcohol + phosphate
Subcellular location Lysosome
Structure Exists either as monomer or, after proteolytic processing, as a dimer of two chains linked by disulfide bond(s)
Involvement in disease Spondyloenchondrodysplasia with immune dysregulation A disease characterized by vertebral and metaphyseal dysplasia, spasticity with cerebral calcifications, and strong predisposition to autoimmune diseases. The skeletal dysplasia is characterized by radiolucent and irregular spondylar and metaphyseal lesions that represent islands of chondroid tissue within bone.
Keywords 3D-structure, Direct protein sequencing, Disease variant, Disulfide bond, Glycoprotein, Hydrolase, Iron, Lysosome, Metal-binding, Proteomics identification, Reference proteome, Signal
Sequence MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQI LGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ IAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKL ARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGH DHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSK EMTVTYIEASGKSLFKTRLPRRARP
UniProt accession: P13686

Data

Human spleen involved by hairy cell leukemia stained with anti-TRAcP antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of leukemia cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-TRAcP monoclonal antibody (ZM174) 6391 react with?

This antibody is reactive with human samples.

What are the recommended storage conditions for the mouse anti-TRAcP monoclonal antibody (ZM174) 6391?

Store the antibody at 2-8°C for short term use. For longer term storage, keep it at -20°C and avoid freeze/thaw cycles.

Which application and sample type is the mouse anti-TRAcP monoclonal antibody (ZM174) 6391 validated for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.