Immunohistochemistry (IHC) : Human type B1 thymoma stained with anti-TdT antibody. Note the immature T-cells are positive.

mouse anti-TdT monoclonal antibody (ZM51) 6378

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to TdT
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Thymus
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6378parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, TdT

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-TdT monoclonal antibody ZM51 6378

antibody
Database link: human P04053
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Thymus
Immunogen Recombinant fragment (around aa 52-192) of human DNTT protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens DNTT DNA nucleotidylexotransferase
Protein names DNA nucleotidylexotransferase
Alternative names Terminal addition enzyme, Terminal deoxynucleotidyltransferase
Gene names DNTT
Protein family Belongs to the DNA polymerase type-X family
Function Template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor gene segments during the maturation of B- and T-cells
Catalytic activity DNA(n) + a 2'-deoxyribonucleoside 5'-triphosphate = DNA(n+1) + diphosphate
Subcellular location Nucleus
Structure Interacts with PRP19 and DNTTIP1. Forms a ternary complex with DNTTIP2 and core histone. Released from this complex by PCNA. Interacts with TRERF1 (PubMed:16371131)
Keywords 3D-structure, Alternative splicing, Magnesium, Metal-binding, Nucleotidyltransferase, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Terminal addition, Transferase
Sequence MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKG FRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMT GKHQLVVRRDYSDSTNPGPPKTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCE FRENEDSCVTFMRAASVLKSLPFTIISMKDTEGIPCLGSKVKGIIEEIIEDGESSEVKAV LNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSDKSLKFTRMQKAGFLYYEDLV SCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITSPGSTEDEEQL LQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSS WQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKT KRIFLKAESEEEIFAHLGLDYIEPWERNA
UniProt accession: P04053

Data

Human type B1 thymoma stained with anti-TdT antibody. Note the immature T-cells are positive.

FAQ & Publications

Frequently Asked Questions

What is the recommended application for the mouse anti-TdT monoclonal antibody ZM51 (SKU 6378)?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

How should the mouse anti-TdT antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, freeze at -20°C and avoid repeated freeze/thaw cycles.

Which species does the mouse anti-TdT monoclonal antibody specifically react with?

This antibody reacts with human TdT protein.

What is the host species and clonality of the anti-TdT antibody ZM51?

The antibody is a monoclonal antibody produced in mouse and is of the IgG1 isotype.

What is the immunogen used to generate the mouse anti-TdT monoclonal antibody ZM51?

The immunogen is a recombinant fragment of the human DNTT protein, approximately amino acids 52 to 192.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.