Immunohistochemistry (IHC) : Human spleen stained with anti-Perforin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic granular staining of cytotoxic T cells.

mouse anti-Perforin monoclonal antibody (ZM159) 6329

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Perforin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2C
Control: Spleen
Visualization: Granular cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6329parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, Perforin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2C
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Perforin monoclonal antibody ZM159 6329

antibody
Database link: human P14222
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Spleen
Immunogen Recombinant human Perforin protein fragment (around aa 413-552)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2c
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2c - Isotype Control

target relevance
Homo sapiens PRF1 Perforin-1
Protein names Perforin-1
Alternative names Cytolysin, Lymphocyte pore-forming protein
Gene names PRF1
Protein family Belongs to the complement C6/C7/C8/C9 family
Function Pore-forming protein that plays a key role in granzyme-mediated programmed cell death, and in defense against virus-infected or neoplastic cells (PubMed:20889983, PubMed:21037563, PubMed:24558045, PubMed:9058810, PubMed:9164947). Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease (PubMed:9058810). Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores (PubMed:20889983, PubMed:21037563). Promotes cytolysis and apoptosis of target cells by mediating the passage and uptake of cytotoxic granzymes (PubMed:20038786, PubMed:20225066, PubMed:24558045, PubMed:32299851). Facilitates the delivery of cationic cargo protein, while anionic or neural proteins are not delivered efficiently (PubMed:24558045). Perforin pores allow the release of mature caspase-7 (CASP7) into the extracellular milieu (By similarity)
Subcellular location Cytolytic granule, Secreted, Cell membrane, Endosome lumen
Structure Monomer, as soluble protein (PubMed:20889983, PubMed:21037563). Homooligomer; homooligomerizes to form a pore-forming ring (PubMed:20889983, PubMed:21037563)
Post-translational modification N-glycosylated
Involvement in disease Hemophagocytic lymphohistiocytosis, familial, 2 A rare disorder characterized by immune dysregulation with hypercytokinemia, defective function of natural killer cell, and massive infiltration of several organs by activated lymphocytes and macrophages. The clinical features of the disease include fever, hepatosplenomegaly, cytopenia, and less frequently neurological abnormalities ranging from irritability and hypotonia to seizures, cranial nerve deficits and ataxia.
Keywords Calcium, Cell membrane, Cytolysis, Disease variant, Disulfide bond, EGF-like domain, Endosome, Familial hemophagocytic lymphohistiocytosis, Glycoprotein, Lysosome, Membrane, Metal-binding, Proteomics identification, Reference proteome, Secreted, Signal, Transmembrane, Transmembrane beta strand
Sequence MAARLLLLGILLLLLPLPVPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD AARSIRNDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYS FHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALR TCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERH SEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREAL RRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT FIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRL QVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQ MLLGEPPGNRSGAVW
UniProt accession: P14222

Data

Human spleen stained with anti-Perforin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic granular staining of cytotoxic T cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Perforin monoclonal antibody (ZM159) specifically react with?

This antibody specifically reacts with human Perforin protein.

Which applications is the mouse anti-Perforin monoclonal antibody (ZM159) validated for?

The antibody is validated for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this antibody to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided.

What is the immunogen used to generate the mouse anti-Perforin monoclonal antibody (ZM159)?

The immunogen is a recombinant human Perforin protein fragment corresponding approximately to amino acids 413-552.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.