Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human bone marrow stained with anti-myeloperoxidase antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of myeloid cells

mouse anti-Myeloperoxidase monoclonal antibody (ZM352) 6276

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Myeloperoxidase
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b/κ
Control: Spleen
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6276parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, Myeloperoxidase

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b/κ
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Myeloperoxidase monoclonal antibody ZM352 6276

antibody
Database link: human P05164
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Spleen
Immunogen Recombinant fragment (around aa150-250) of human MPO protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens MPO Myeloperoxidase
Protein names Myeloperoxidase
Gene names MPO
Protein family Belongs to the peroxidase family. XPO subfamily
Function Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid in physiologic situations, and other toxic intermediates that greatly enhance PMN microbicidal activity (PubMed:9922160). Mediates the proteolytic cleavage of alpha-1-microglobulin to form t-alpha-1-microglobulin, which potently inhibits oxidation of low-density lipoprotein particles and limits vascular damage (PubMed:25698971)
Catalytic activity chloride + H2O2 + H(+) = hypochlorous acid + H2O
Subcellular location Lysosome
Structure Homodimer; disulfide-linked. Each monomer consists of a light and a heavy chain. Found in a complex with CP and LTF; interacts directly with CP, which protects CP antioxidant properties by MPO (PubMed:23843990)
Involvement in disease Myeloperoxidase deficiency A disorder characterized by decreased myeloperoxidase activity in neutrophils and monocytes that results in disseminated candidiasis.
Keywords 3D-structure, Alternative splicing, Calcium, Direct protein sequencing, Disease variant, Disulfide bond, Glycoprotein, Heme, Hydrogen peroxide, Iron, Lysosome, Metal-binding, Oxidation, Oxidoreductase, Peroxidase, Proteomics identification, Reference proteome, Signal
Sequence MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS NSYPRDFVNCSTLPALNLASWREAS
UniProt accession: P05164

Data

Formalin-fixed, paraffin-embedded human bone marrow stained with anti-myeloperoxidase antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of myeloid cells

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Myeloperoxidase monoclonal antibody (ZM352) specifically react with?

This monoclonal antibody specifically reacts with human Myeloperoxidase, making it suitable for studies involving human tissues.

What are the recommended storage conditions for this mouse anti-Myeloperoxidase antibody to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store it at -20°C and avoid repeated freeze-thaw cycles to maintain antibody integrity.

Can you describe the suitable application and recommended dilution for using this antibody in immunohistochemistry?

This antibody is optimized for immunohistochemistry on formalin-fixed, paraffin-embedded human tissues. When using the concentrated form, a dilution of 1:100 to 1:200 is recommended for optimal staining results.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.