Immunohistochemistry (IHC) : Human lymph node stained with anti-Lysozyme antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of perifollicular neutrophils and histiocytes..

mouse anti-Lysozyme monoclonal antibody (ZM120) 6244

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Lysozyme
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Myeloid leukemia
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6244parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, Lysozyme

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Lysozyme monoclonal antibody ZM120 6244

antibody
Database link: human P61626
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Myeloid leukemia
Immunogen Recombinant fragment of human Lysozyme protein (around aa 18-147)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens LYZ Lysozyme C
Protein names Lysozyme C
Alternative names 1,4-beta-N-acetylmuramidase C
Gene names LYZ
Protein family Belongs to the glycosyl hydrolase 22 family
Function Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents
Catalytic activity Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.
Subcellular location Secreted
Structure Monomer
Involvement in disease Amyloidosis, hereditary systemic 5 A form of hereditary systemic amyloidosis, a disorder characterized by amyloid deposition in multiple tissues resulting in a wide clinical spectrum. AMYLD5 primarily affects the viscera, and the predominant clinical features are renal dysfunction of varying severity, and intra-abdominal bleeding. Inheritance is autosomal dominant.
Keywords 3D-structure, Amyloid, Amyloidosis, Antimicrobial, Bacteriolytic enzyme, Direct protein sequencing, Disease variant, Disulfide bond, Glycosidase, Hydrolase, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD PQGIRAWVAWRNRCQNRDVRQYVQGCGV
UniProt accession: P61626

Data

Human lymph node stained with anti-Lysozyme antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of perifollicular neutrophils and histiocytes..

FAQ & Publications

Frequently Asked Questions

What is the recommended application for the mouse anti-Lysozyme monoclonal antibody (ZM120)?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

Which species does the mouse anti-Lysozyme monoclonal antibody (ZM120) react with?

The antibody reacts specifically with human Lysozyme.

What are the storage conditions for the mouse anti-Lysozyme monoclonal antibody (ZM120)?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided.

What is the host and isotype of the mouse anti-Lysozyme monoclonal antibody (ZM120)?

The antibody is a mouse monoclonal of the IgG2b isotype.

What immunogen was used to generate the mouse anti-Lysozyme monoclonal antibody (ZM120)?

The immunogen was a recombinant fragment of human Lysozyme protein, approximately amino acids 18-147.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.