| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2a |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
mouse anti-Lambda monoclonal antibody (LcN-2) 6239
Price range: $160.00 through $528.00
Antibody summary
- Mouse monoclonal to Lambda
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG2a
- Control: Tonsil
- Visualization: Cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
mouse anti-Lambda monoclonal antibody LcN-2 6239
| target relevance |
|---|
| Homo sapiens IGLV1-40 Immunoglobulin lambda variable 1-40 |
| Protein names Immunoglobulin lambda variable 1-40 |
| Alternative names Ig lambda chain V-I region NEWM |
| Gene names IGLV1-40 |
| Function V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268) |
| Subcellular location Secreted, Cell membrane |
| Structure Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked |
| Keywords Adaptive immunity, Cell membrane, Direct protein sequencing, Disulfide bond, Immunity, Immunoglobulin, Immunoglobulin domain, Membrane, Proteomics identification, Pyrrolidone carboxylic acid, Reference proteome, Secreted, Signal |
| Sequence MAWSPLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQL PGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSG |
| UniProt accession: P01703 |
Data
![]() |
| Human tonsil stained with anti-Lambda light chain antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of plasma cells. |
FAQ & Publications
Frequently Asked Questions
What is the recommended application and dilution for the mouse anti-Lambda monoclonal antibody (LcN-2) 6239?
This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. The recommended dilution for the concentrated antibody is 1:100 to 1:200.
How should the mouse anti-Lambda monoclonal antibody LcN-2 (6239) be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. It is important to avoid repeated freeze/thaw cycles to preserve antibody integrity.
Which secondary antibodies are compatible with the mouse anti-Lambda monoclonal antibody (LcN-2) 6239 for detection?
Compatible secondary antibodies include goat anti-mouse IgG, H&L chain specific polyclonal antibodies conjugated to peroxidase, biotin, or FITC. Both crossabsorbed and non-crossabsorbed variants are suitable, such as antibodies with catalog numbers 5486, 2685, 7854, 1706, 1716, and 1721.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.