Skip to content

mouse anti-Lambda monoclonal antibody (LcN-2) 6239

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to Lambda
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG2a
  • Control: Tonsil
  • Visualization: Cytoplasmic
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
SKU: 6239parent Categories: , Tags: , ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG2a

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Lambda monoclonal antibody LcN-2 6239

antibody
Database link:
human P01703
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Tonsil
Immunogen
Purified human IgG
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG2a
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG2a - Isotype Control
target relevance
Homo sapiens IGLV1-40
Immunoglobulin lambda variable 1-40
Protein names
Immunoglobulin lambda variable 1-40
Alternative names
Ig lambda chain V-I region NEWM
Gene names
IGLV1-40
Function
V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268)
Subcellular location
Secreted, Cell membrane
Structure
Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked
Keywords
Adaptive immunity, Cell membrane, Direct protein sequencing, Disulfide bond, Immunity, Immunoglobulin, Immunoglobulin domain, Membrane, Proteomics identification, Pyrrolidone carboxylic acid, Reference proteome, Secreted, Signal
Sequence
MAWSPLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQL PGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSG
UniProt accession: P01703

Data

Human tonsil stained with anti-Lambda light chain antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of plasma cells.
Human tonsil stained with anti-Lambda light chain antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of plasma cells.

FAQ & Publications

Frequently Asked Questions
What is the recommended application and dilution for the mouse anti-Lambda monoclonal antibody (LcN-2) 6239?
This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. The recommended dilution for the concentrated antibody is 1:100 to 1:200.
How should the mouse anti-Lambda monoclonal antibody LcN-2 (6239) be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. It is important to avoid repeated freeze/thaw cycles to preserve antibody integrity.
Which secondary antibodies are compatible with the mouse anti-Lambda monoclonal antibody (LcN-2) 6239 for detection?
Compatible secondary antibodies include goat anti-mouse IgG, H&L chain specific polyclonal antibodies conjugated to peroxidase, biotin, or FITC. Both crossabsorbed and non-crossabsorbed variants are suitable, such as antibodies with catalog numbers 5486, 2685, 7854, 1706, 1716, and 1721.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.