Skip to content

mouse anti-Kappa monoclonal antibody (ZM81) 6235

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to Kappa
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG1
  • Control: Tonsil or lymph node
  • Visualization: Cytoplasmic
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
SKU: 6235parent Categories: , Tags: , ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Kappa monoclonal antibody ZM81 6235

antibody
Database link:
human P01601
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Tonsil or lymph node
Immunogen
Recombinant full-length human IGKC protein
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG1 - Isotype Control
target relevance
Homo sapiens IGKV1D-16
Immunoglobulin kappa variable 1D-16
Protein names
Immunoglobulin kappa variable 1D-16
Alternative names
Ig kappa chain V-I region HK146, Ig kappa chain V-I region HK189
Gene names
IGKV1D-16
Function
V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268)
Subcellular location
Secreted, Cell membrane
Structure
Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked
Keywords
Adaptive immunity, Cell membrane, Disulfide bond, Immunity, Immunoglobulin, Immunoglobulin domain, Membrane, Proteomics identification, Reference proteome, Secreted, Signal
Sequence
MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQ KPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP
UniProt accession: P01601

Data

Human tonsil stained with anti-Kappa light chain antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of plasma cells.
Human tonsil stained with anti-Kappa light chain antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of plasma cells.

FAQ & Publications

Frequently Asked Questions
What species does the mouse anti-Kappa monoclonal antibody (ZM81) specifically react with?
This antibody reacts specifically with human Kappa light chains.
What is the recommended dilution and application for using this antibody in immunohistochemistry?
For immunohistochemistry on formalin-fixed, paraffin-embedded tissues, the concentrated antibody is recommended to be diluted between 1:100 and 1:200.
How should the mouse anti-Kappa monoclonal antibody (ZM81) be stored to maintain its stability?
For short-term storage, keep the antibody at 2-8°C, and for longer-term storage, it should be kept at -20°C while avoiding repeated freeze-thaw cycles.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.