| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
mouse anti-Kappa monoclonal antibody (ZM81) 6235
Price range: $160.00 through $528.00
Antibody summary
- Mouse monoclonal to Kappa
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG1
- Control: Tonsil or lymph node
- Visualization: Cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
mouse anti-Kappa monoclonal antibody ZM81 6235
| target relevance |
|---|
| Homo sapiens IGKV1D-16 Immunoglobulin kappa variable 1D-16 |
| Protein names Immunoglobulin kappa variable 1D-16 |
| Alternative names Ig kappa chain V-I region HK146, Ig kappa chain V-I region HK189 |
| Gene names IGKV1D-16 |
| Function V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268) |
| Subcellular location Secreted, Cell membrane |
| Structure Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked |
| Keywords Adaptive immunity, Cell membrane, Disulfide bond, Immunity, Immunoglobulin, Immunoglobulin domain, Membrane, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQ KPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP |
| UniProt accession: P01601 |
Data
![]() |
| Human tonsil stained with anti-Kappa light chain antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of plasma cells. |
FAQ & Publications
Frequently Asked Questions
What species does the mouse anti-Kappa monoclonal antibody (ZM81) specifically react with?
This antibody reacts specifically with human Kappa light chains.
What is the recommended dilution and application for using this antibody in immunohistochemistry?
For immunohistochemistry on formalin-fixed, paraffin-embedded tissues, the concentrated antibody is recommended to be diluted between 1:100 and 1:200.
How should the mouse anti-Kappa monoclonal antibody (ZM81) be stored to maintain its stability?
For short-term storage, keep the antibody at 2-8°C, and for longer-term storage, it should be kept at -20°C while avoiding repeated freeze-thaw cycles.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.