Immunohistochemistry (IHC) : Human tonsil stained with anti-CD4 using peroxidase-conjugate and DAB chromogen. Note cell membrane staining of T cells.

mouse anti-CD4 monoclonal antibody (ZM180) 6092

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD4
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Tonsil
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6092parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD4, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD4 monoclonal antibody ZM180 6092

antibody
Database link: human P01730
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil
Immunogen Recombinant fragment (around aa 216-396) of human CD4 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens CD4 T-cell surface glycoprotein CD4
Protein names T-cell surface glycoprotein CD4
Alternative names T-cell surface antigen T4/Leu-3
Gene names CD4
Function Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages
Subcellular location Cell membrane
Structure (Microbial infection) Interacts with Human Herpes virus 7 surface proteins
Post-translational modification Palmitoylation and association with LCK contribute to the enrichment of CD4 in lipid rafts Phosphorylated by PKC; phosphorylation at Ser-433 plays an important role for CD4 internalization
Involvement in disease Immunodeficiency 79 An autosomal recessive disorder characterized by childhood onset of recurrent and recalcitrant skin warts due to uncontrolled viral infection with human papillomavirus (HPV). Some patients may also have recurrent respiratory infections. Laboratory studies show a complete absence of CD4+ T cells.
Keywords 3D-structure, Adaptive immunity, Cell membrane, Direct protein sequencing, Disulfide bond, Glycoprotein, Host cell receptor for virus entry, Host-virus interaction, Immunity, Immunoglobulin domain, Lipoprotein, Membrane, Palmitate, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
UniProt accession: P01730

Data

Human tonsil stained with anti-CD4 using peroxidase-conjugate and DAB chromogen. Note cell membrane staining of T cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-CD4 monoclonal antibody (ZM180) specifically react with?

This antibody reacts specifically with human CD4 protein.

Which application has this mouse anti-CD4 antibody been validated for?

The antibody is validated for immunohistochemistry (IHC), particularly on formalin-fixed, paraffin-embedded tissue samples.

What are the recommended storage conditions for this anti-CD4 antibody to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C while avoiding repeated freeze-thaw cycles.

What is the host species and clonality of the anti-CD4 antibody ZM180?

The antibody is a mouse monoclonal antibody with an IgG2a isotype.

What immunogen was used to generate the mouse anti-CD4 monoclonal antibody (ZM180)?

The immunogen used was a recombinant fragment of human CD4 protein spanning approximately amino acids 216 to 396.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.