Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human spleen stained with anti-CD33 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of myeloid cells

mouse anti-CD33 monoclonal antibody (PWS44) 6087

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD33
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Spleen
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6087parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD33, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD33 monoclonal antibody PWS44 6087

antibody
Database link: human P20138
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Spleen
Immunogen Prokaryotic recombinant protein corresponding to a region of the C2 domain of the human CD33 molecule
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens CD33 Myeloid cell surface antigen CD33
Protein names Myeloid cell surface antigen CD33
Alternative names Sialic acid-binding Ig-like lectin 3, gp67
Gene names CD33
Protein family Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family
Function Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:11320212, PubMed:15597323). Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans (PubMed:7718872). Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK (PubMed:10887109, PubMed:28325905). These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:10206955, PubMed:10556798, PubMed:10887109). In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules (PubMed:10206955, PubMed:10887109). One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K (PubMed:15597323)
Subcellular location Peroxisome
Structure Homodimer; disulfide-linked (PubMed:10887109). Interacts with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation (PubMed:10206955, PubMed:10556798). Interacts with C1QA (via C-terminus); this interaction activates CD33 inhibitory motifs (PubMed:28325905)
Post-translational modification Glycosylated. Glycosylation at Asn-100 is critical for regulating ligand recognition Phosphorylation of Tyr-340 is involved in binding to PTPN6 and PTPN11. Phosphorylation of Tyr-358 is involved in binding to PTPN6. LCK phosphorylates Tyr-340 efficiently and Tyr-358 to a lesser extent
Keywords 3D-structure, Alternative splicing, Cell adhesion, Cell membrane, Disulfide bond, Glycoprotein, Immunoglobulin domain, Lectin, Membrane, Peroxisome, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYW FREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRM ERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWL SAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTT GIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTH PTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSE VRTQ
UniProt accession: P20138

Data

Formalin-fixed, paraffin-embedded human spleen stained with anti-CD33 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of myeloid cells

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-CD33 monoclonal antibody (PWS44) 6087 specifically react with?

This antibody specifically reacts with human CD33 protein.

Which application is this mouse anti-CD33 monoclonal antibody validated for and what is the recommended dilution?

The antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with a recommended dilution of 1:50 to 1:100 for the concentrated form.

How should the mouse anti-CD33 monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, freeze it at -20°C while avoiding freeze/thaw cycles.

What is the immunogen used to generate the mouse anti-CD33 monoclonal antibody (PWS44) 6087?

The immunogen is a prokaryotic recombinant protein corresponding to a region of the C2 domain of the human CD33 molecule.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.