| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
mouse anti-CD30 monoclonal antibody (Ber-H2) 6083
Price range: $160.00 through $528.00
Antibody summary
- Mouse monoclonal to CD30
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG1
- Control: Hodgkin lymphoma or anaplastic large cell lymphoma
- Visualization: Cell membrane and cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
mouse anti-CD30 monoclonal antibody Ber-H2 6083
| antibody |
|---|
| Database link: human P28908 |
| Tested applications IHC |
| Recommended dilutions Concentrated 1:100-200 |
| Application Notes Positive control: Hodgkin lymphoma or anaplastic large cell lymphoma |
| Immunogen Co cell line established from a patient with Hodgkin's disease of T-cell lineage |
| Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated |
| Form liquid |
| Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles. |
| Purity affinity purified |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monoclonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens TNFRSF8 Tumor necrosis factor receptor superfamily member 8 |
| Protein names Tumor necrosis factor receptor superfamily member 8 |
| Alternative names CD30L receptor, Ki-1 antigen, Lymphocyte activation antigen CD30 |
| Gene names TNFRSF8 |
| Protein family Belongs to the TNFR8 family |
| Function Receptor for TNFSF8/CD30L (PubMed:8391931). May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B (PubMed:8999898) |
| Subcellular location Cytoplasm |
| Structure Interacts with TRAF1, TRAF2, TRAF3 and TRAF5 |
| Post-translational modification Phosphorylated on serine and tyrosine residues (Probable). Isoform 2 is constitutively phosphorylated (PubMed:8839832) |
| Keywords 3D-structure, Alternative initiation, Alternative splicing, Cell membrane, Cytoplasm, Disulfide bond, Glycoprotein, Membrane, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix |
| Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK |
| UniProt accession: P28908 |
Data
![]() |
| Human Hodgkin lymphoma stained with anti-CD30 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of Hodgkin's cells. |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution for the concentrated mouse anti-CD30 monoclonal antibody (Ber-H2) in immunohistochemistry applications?
The recommended dilution for the concentrated mouse anti-CD30 monoclonal antibody (Ber-H2) in immunohistochemistry (IHC) is between 1:100 and 1:200.
How should the mouse anti-CD30 monoclonal antibody (Ber-H2) be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to maintain antibody stability.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.