Immunohistochemistry (IHC) : Human skin stained with anti-CD1a antibody using peroxidase-conjugate and DAB chromogen. Note membrane staining of langerhan cells.

mouse anti-CD1a monoclonal antibody (O10) 6069

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD1a
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Skin or Langerhans cell histiocytosis X
Visualization: Cell membrane and cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6069parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD1A, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD1a monoclonal antibody O10 6069

antibody
Database link: human P06126
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Skin or Langerhans cell histiocytosis X
Immunogen CD1a
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens CD1A T-cell surface glycoprotein CD1a
Protein names T-cell surface glycoprotein CD1a
Alternative names T-cell surface antigen T6/Leu-6
Gene names CD1A
Function Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells
Subcellular location Cell membrane, Membrane raft, Endosome membrane
Structure Heterodimer with B2M (beta-2-microglobulin). Interacts with CD74
Keywords 3D-structure, Adaptive immunity, Cell membrane, Disulfide bond, Endosome, Glycoprotein, Immunity, Immunoglobulin domain, Membrane, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix
Sequence MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSN SSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCE LHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLS DTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRG EQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVKHSSLEGQDIVLYWEHHSSV GFIILAVIVPLLLLIGLALWFRKRCFC
UniProt accession: P06126

Data

Human skin stained with anti-CD1a antibody using peroxidase-conjugate and DAB chromogen. Note membrane staining of langerhan cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-CD1a monoclonal antibody (O10) react with?

This antibody specifically reacts with human CD1a antigen.

Which applications is the mouse anti-CD1a monoclonal antibody (O10) validated for?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-CD1a antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, freeze at -20°C and avoid freeze/thaw cycles.

What is the recommended dilution for using the concentrated form of this antibody in IHC?

The concentrated antibody should be diluted between 1:50 and 1:100 for immunohistochemistry applications.

What controls are recommended when using the mouse anti-CD1a monoclonal antibody (O10) in experiments?

Skin tissue or Langerhans cell histiocytosis X samples are recommended as positive controls for this antibody.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.