Immunohistochemistry (IHC) : Human spleen stained with anti-CD13 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of myeloid cells.

mouse anti-CD13 monoclonal antibody (ZM287) 6060

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD13
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Myeloid leukemia
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6060parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD13, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD13 monoclonal antibody ZM287 6060

antibody
Database link: human P15144
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Myeloid leukemia
Immunogen Recombinant fragment (around aa50-250) of human ANPEP protein (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens ANPEP Aminopeptidase N
Protein names Aminopeptidase N
Alternative names Alanyl aminopeptidase, Aminopeptidase M, Microsomal aminopeptidase, Myeloid plasma membrane glycoprotein CD13, gp150
Gene names ANPEP
Protein family Belongs to the peptidase M1 family
Function Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis and promote cholesterol crystallization. May have a role in amino acid transport by acting as binding partner of amino acid transporter SLC6A19 and regulating its activity (By similarity)
Catalytic activity Release of an N-terminal amino acid, Xaa-\|-Yaa- from a peptide, amide or arylamide. Xaa is preferably Ala, but may be most amino acids including Pro (slow action). When a terminal hydrophobic residue is followed by a prolyl residue, the two may be released as an intact Xaa-Pro dipeptide.
Subcellular location Cell membrane
Structure (Microbial infection) Interacts with the S1 domain of human coronavirus 229E/HCoV-229E spike protein
Post-translational modification Sulfated N- and O-glycosylated May undergo proteolysis and give rise to a soluble form
Keywords 3D-structure, Aminopeptidase, Angiogenesis, Cell membrane, Developmental protein, Differentiation, Direct protein sequencing, Disulfide bond, Glycoprotein, Host cell receptor for virus entry, Host-virus interaction, Hydrolase, Membrane, Metal-binding, Metalloprotease, Protease, Proteomics identification, Receptor, Reference proteome, Signal-anchor, Sulfation, Transmembrane, Transmembrane helix, Zinc
Sequence MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDS EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP KDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKG ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIM NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQ IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKN YLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ WFTENSK
UniProt accession: P15144

Data

Human spleen stained with anti-CD13 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of myeloid cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended application and dilution for the mouse anti-CD13 monoclonal antibody (ZM287) 6060?

This mouse anti-CD13 monoclonal antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. The recommended dilution for the concentrated antibody is between 1:100 and 1:200.

How should the mouse anti-CD13 monoclonal antibody (ZM287) 6060 be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. It is important to avoid freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.