Immunohistochemistry (IHC) : Human lymph node stained with anti-BOB1 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear and cytoplasmic staining of follicular center B cells .

mouse anti-BOB1 monoclonal antibody (ZM74) 6444

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to BOB1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Tonsil
Visualization: Cytoplasmic and nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6444parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, BOB1, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-BOB1 monoclonal antibody ZM74 6444

antibody
Database link: human Q16633
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Tonsil
Immunogen Recombinant full-length human beta-catenin (CTNNB1) protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens POU2AF1 POU domain class 2-associating factor 1
Protein names POU domain class 2-associating factor 1
Alternative names B-cell-specific coactivator OBF-1, BOB-1, OCA-B, OCT-binding factor 1
Gene names POU2AF1
Protein family Belongs to the POU2AF family
Function Transcriptional coactivator that specifically associates with either POU2F1/OCT1 or POU2F2/OCT2 (PubMed:7859290). It boosts the POU2F1/OCT1 mediated promoter activity and to a lesser extent, that of POU2F2/OCT2 (PubMed:7779176). It recognizes the POU domains of POU2F1/OCT1 and POU2F2/OCT2 (PubMed:7779176). It is essential for the response of B-cells to antigens and required for the formation of germinal centers (PubMed:7623806, PubMed:7859290). Regulates IL6 expression in B cells as POU2F2/OCT2 coactivator (By similarity)
Subcellular location Nucleus
Structure Interacts with POU2F1/OCT1 and POU2F2/OCT2; the interaction increases POU2F1 and POU2F2 transactivation activity
Post-translational modification Ubiquitinated; mediated by SIAH1 or SIAH2 and leading to its subsequent proteasomal degradation
Keywords 3D-structure, Activator, Chromosomal rearrangement, Direct protein sequencing, Nucleus, Proteomics identification, Proto-oncogene, Reference proteome, Transcription, Transcription regulation, Ubl conjugation
Sequence MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATY TTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSA DMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWP QPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEE DSDAYALNHTLSVEGF
UniProt accession: Q16633

Data

Human lymph node stained with anti-BOB1 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear and cytoplasmic staining of follicular center B cells .

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-BOB1 monoclonal antibody (ZM74) specifically react with?

This antibody specifically reacts with human tissues.

For which application has the mouse anti-BOB1 monoclonal antibody (ZM74) been tested and recommended?

It has been tested and is recommended for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for maintaining the stability of the mouse anti-BOB1 monoclonal antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C while avoiding repeated freeze/thaw cycles.

What types and sizes of the mouse anti-BOB1 monoclonal antibody (ZM74) are available for purchase?

The antibody is available as concentrated solutions in 0.1 mL, 0.5 mL, and 1.0 mL sizes, as well as a 7 mL prediluted format.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.