Immunohistochemistry (IHC) : Human tonsil stained with anti-CD8 antibody using peroxidase-conjugate and DAB chromogen. Not the membrane staining of perifollicular T-cells.

rabbit anti-CD8 monoclonal antibody (ZR286) 6115

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD8
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Lymph node
Visualization: Cell membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6115parent Category: antibody Tags: anatomy, CD8, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD8 monoclonal antibody ZR286 6115

antibody
Database link: human P01732 Database link: human P01731
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Lymph node
Immunogen Human CD8 recombinant protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Protein names T-cell surface glycoprotein CD8 alpha chain (T-lymphocyte differentiation antigen T8/Leu-2) (CD antigen CD8a)
Gene names CD8A,CD8A MAL
Mass 25729Da
Catalytic activity CD8A MAL
Pathway 9606
Subellular location CD8A MAL
Domain MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Target Relevance information above includes information from UniProt accession: P01732
The UniProt Consortium

Data

Human tonsil stained with anti-CD8 antibody using peroxidase-conjugate and DAB chromogen. Not the membrane staining of perifollicular T-cells.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.