Skip to content

rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009

$409.00

Antibody summary

  • Rabbit monoclonal to Tyrosine Hydroxylase
  • Suitable for: WB, ICC/IF
  • Reacts with: human, mouse, rat
  • Isotype: IgG
  • 100 µg
SKU: 9009 Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

monoclonal

concentration

1 mg/mL

applications

ICC/IF, WB

available sizes

100 µg

rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009

antibody
Database link:
human P07101
mouse P24529
rat P04177
Tested applications
WB,ICC/IF
Recommended dilutions
WB: 1:5000 IF/ICC 1:10000
Immunogen
Full length human TH expressed in and purified from E. coli.
Size and concentration
100µg and 1 mg/mL
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer
PBS, 50% glycerol, 0.04% NaN3
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit monoclonal - Isotype Control
target relevance
Homo sapiens TH
Tyrosine 3-monooxygenase
Protein names
Tyrosine 3-monooxygenase
Alternative names
Tyrosine 3-hydroxylase
Gene names
TH
Protein family
Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
Function
Catalyzes the conversion of L-tyrosine to L-dihydroxyphenylalanine (L-Dopa), the rate-limiting step in the biosynthesis of catecholamines, dopamine, noradrenaline, and adrenaline. Uses tetrahydrobiopterin and molecular oxygen to convert tyrosine to L-Dopa (PubMed:15287903, PubMed:1680128, PubMed:17391063, PubMed:24753243, PubMed:34922205, PubMed:8528210, Ref.18). In addition to tyrosine, is able to catalyze the hydroxylation of phenylalanine and tryptophan with lower specificity (By similarity). Positively regulates the regression of retinal hyaloid vessels during postnatal development (By similarity)
Catalytic activity
(6R)-L-erythro-5,6,7,8-tetrahydrobiopterin + L-tyrosine + O2 = (4aS,6R)-4a-hydroxy-L-erythro-5,6,7,8-tetrahydrobiopterin + L-dopa
Subcellular location
Cytoplasm, perinuclear region, Nucleus, Cell projection, axon, Cytoplasm, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle
Structure
Homotetramer (PubMed:24947669, Ref.18). Interacts (when phosphorylated at Ser-19) with YWHAG; one YWHAG dimer binds to one TH tetramer and this interaction may influence the phosphorylation and dephosphorylation of other sites (PubMed:24947669). Interacts with NT5DC2; the interaction results in reduced phosphorylation and decreased catalytic activity of TH (By similarity)
Post-translational modification
Phosphorylated on Ser-19, Ser-62 and Ser-71 by several protein kinases with different site specificities. Phosphorylation at Ser-62 and Ser-71 leads to an increase of TH activity (PubMed:7901013). Phosphorylation at Ser-71 activates the enzyme and also counteracts the feedback inhibition of TH by catecholamines (PubMed:15287903). Phosphorylation of Ser-19 and Ser-62 triggers the proteasomal degradation of TH through the ubiquitin-proteasome pathway (By similarity). Phosphorylation at Ser-62 facilitates transport of TH from the soma to the nerve terminals via the microtubule network (PubMed:28637871). Phosphorylation at Ser-19 induces the high-affinity binding to the 14-3-3 protein YWHAG; this interaction may influence the phosphorylation and dephosphorylation of other sites (PubMed:24947669). Ser-19 increases the phosphorylation at Ser-71 in a hierarchical manner, leading to increased activity (By similarity)
Involvement in disease
Segawa syndrome autosomal recessive
A form of DOPA-responsive dystonia presenting in infancy or early childhood. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. Some cases present with parkinsonian symptoms in infancy. Unlike all other forms of dystonia, it is an eminently treatable condition, due to a favorable response to L-DOPA.

Keywords
3D-structure, Alternative splicing, Catecholamine biosynthesis, Cell projection, Cytoplasm, Cytoplasmic vesicle, Disease variant, Dystonia, Iron, Metal-binding, Monooxygenase, Neurotransmitter biosynthesis, Nucleus, Oxidoreductase, Parkinson disease, Parkinsonism, Phosphoprotein, Proteomics identification, Reference proteome, Synapse
Sequence
MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTP RSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLEAVAFEEKEGKAVLNLLFSPR ATKPSALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVR QVSEDVRSPAGPKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEI AFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNI PQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCC HELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYG AGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYAS RIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
UniProt accession: P07101

Data

benchmarkantibodies.com/wp-content/uploads/2024/03/9009_1.jpg
Detection of human Tyrosine Hydroxylase in FFPE mouse brain by immunohistochemistry. Antibody: Rabbit anti-Tyrosine Hydroxylase recombinant monoclonal antibody. Secondary: HRP-conjugated goat anti-rabbit IgG. Substrate: DAB.
benchmarkantibodies.com/wp-content/uploads/2024/03/9009_2.jpg
Detection of human Tyrosine Hydroxylase in FFPE SK-N-BE(2) cells by immunocytochemistry. Antibody: Rabbit anti-Tyrosine Hydroxylase recombinant monoclonal antibody. Secondary: HRP-conjugated goat anti-rabbit IgG. Substrate: DAB.
benchmarkantibodies.com/wp-content/uploads/2024/03/9009_3.jpg
Detection of human Tyrosine Hydroxylase by Western blot. Samples: Whole cell lysate (10 µg) from HEK293T, SK-N-SH, SK-N-BE(2), Jurkat, and SK-N-MC cells prepared using NETN lysis buffer. Antibody: Rabbit anti-Tyrosine Hydroxylase recombinant monoclonal antibody used at 1:1000. Secondary: HRP-conjugated goat anti-rabbit IgG. Detection: Chemiluminescence with an exposure time of 30 seconds. Lower Panel: Rabbit anti-COPB2 antibody.
benchmarkantibodies.com/wp-content/uploads/2024/03/9009_4.jpg
Detection of human Tyrosine Hydroxylase in FFPE mouse olfactory bulb by immunohistochemistry. Antibody: Rabbit anti-Tyrosine Hydroxylase recombinant monoclonal antibody. Secondary: HRP-conjugated goat anti-rabbit IgG. Substrate: DAB.
benchmarkantibodies.com/wp-content/uploads/2024/03/9009_5.jpg
Detection of human Tyrosine Hydroxylase by Western blot. Samples: Whole cell lysate (10 µg) from HEK293T, SK-N-SH, SK-N-BE(2), Jurkat, and SK-N-MC cells prepared using NETN lysis buffer. Antibody: Rabbit anti-Tyrosine Hydroxylase recombinant monoclonal antibody used at 1:1000. Secondary: HRP-conjugated goat anti-rabbit IgG. Detection: Chemiluminescence with an exposure time of 30 seconds. Lower Panel: Rabbit anti-COPB2 antibody.

FAQ & Publications

Frequently Asked Questions
What species does the rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009 react with?
This antibody reacts with human, mouse, and rat samples.
For which applications has the rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009 been validated?
The antibody is suitable for Western blot (WB) and immunocytochemistry/immunofluorescence (ICC/IF) applications.
How should the rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009 be stored to maintain stability?
Store the antibody at 2-8°C for short term use and at -20°C for longer term storage, avoiding freeze/thaw cycles.
What is the concentration and form of the rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009 provided?
The antibody is supplied as a liquid at a concentration of 1 mg/mL.
What immunogen was used to generate the rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009?
The immunogen is full-length human Tyrosine Hydroxylase expressed in and purified from E. coli.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.