rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009

$409.00

Antibody summary

Rabbit monoclonal to Tyrosine Hydroxylase
Suitable for: WB, ICC/IF
Reacts with: human, mouse, rat
Isotype: IgG
100 µg

SKU: 9009 Categories: antibody, cell marker Tag: Tyrosine Hydroxylase

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	monoclonal
concentration	1 mg/mL
applications	ICC/IF, WB
available sizes	100 µg

rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009

antibody
Database link: human P07101 mouse P24529 rat P04177
Tested applications WB,ICC/IF
Recommended dilutions WB: 1:5000 IF/ICC 1:10000
Immunogen Full length human TH expressed in and purified from E. coli.
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, 50% glycerol, 0.04% NaN₃
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit monoclonal - Isotype Control

target relevance
Homo sapiens TH Tyrosine 3-monooxygenase
Protein names Tyrosine 3-monooxygenase
Alternative names Tyrosine 3-hydroxylase
Gene names TH
Protein family Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
Function Catalyzes the conversion of L-tyrosine to L-dihydroxyphenylalanine (L-Dopa), the rate-limiting step in the biosynthesis of catecholamines, dopamine, noradrenaline, and adrenaline. Uses tetrahydrobiopterin and molecular oxygen to convert tyrosine to L-Dopa (PubMed:15287903, PubMed:1680128, PubMed:17391063, PubMed:24753243, PubMed:34922205, PubMed:8528210, Ref.18). In addition to tyrosine, is able to catalyze the hydroxylation of phenylalanine and tryptophan with lower specificity (By similarity). Positively regulates the regression of retinal hyaloid vessels during postnatal development (By similarity)
Catalytic activity (6R)-L-erythro-5,6,7,8-tetrahydrobiopterin + L-tyrosine + O2 = (4aS,6R)-4a-hydroxy-L-erythro-5,6,7,8-tetrahydrobiopterin + L-dopa
Subcellular location Cytoplasm, perinuclear region, Nucleus, Cell projection, axon, Cytoplasm, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle
Structure Homotetramer (PubMed:24947669, Ref.18). Interacts (when phosphorylated at Ser-19) with YWHAG; one YWHAG dimer binds to one TH tetramer and this interaction may influence the phosphorylation and dephosphorylation of other sites (PubMed:24947669). Interacts with NT5DC2; the interaction results in reduced phosphorylation and decreased catalytic activity of TH (By similarity)
Post-translational modification Phosphorylated on Ser-19, Ser-62 and Ser-71 by several protein kinases with different site specificities. Phosphorylation at Ser-62 and Ser-71 leads to an increase of TH activity (PubMed:7901013). Phosphorylation at Ser-71 activates the enzyme and also counteracts the feedback inhibition of TH by catecholamines (PubMed:15287903). Phosphorylation of Ser-19 and Ser-62 triggers the proteasomal degradation of TH through the ubiquitin-proteasome pathway (By similarity). Phosphorylation at Ser-62 facilitates transport of TH from the soma to the nerve terminals via the microtubule network (PubMed:28637871). Phosphorylation at Ser-19 induces the high-affinity binding to the 14-3-3 protein YWHAG; this interaction may influence the phosphorylation and dephosphorylation of other sites (PubMed:24947669). Ser-19 increases the phosphorylation at Ser-71 in a hierarchical manner, leading to increased activity (By similarity)
Involvement in disease Segawa syndrome autosomal recessive A form of DOPA-responsive dystonia presenting in infancy or early childhood. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. Some cases present with parkinsonian symptoms in infancy. Unlike all other forms of dystonia, it is an eminently treatable condition, due to a favorable response to L-DOPA.
Keywords 3D-structure, Alternative splicing, Catecholamine biosynthesis, Cell projection, Cytoplasm, Cytoplasmic vesicle, Disease variant, Dystonia, Iron, Metal-binding, Monooxygenase, Neurotransmitter biosynthesis, Nucleus, Oxidoreductase, Parkinson disease, Parkinsonism, Phosphoprotein, Proteomics identification, Reference proteome, Synapse
Sequence MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTP RSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLEAVAFEEKEGKAVLNLLFSPR ATKPSALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVR QVSEDVRSPAGPKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEI AFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNI PQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCC HELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYG AGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYAS RIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
UniProt accession: P07101

Data

benchmarkantibodies.com/wp-content/uploads/2024/03/9009_1.jpg

Detection of human Tyrosine Hydroxylase in FFPE mouse brain by immunohistochemistry. Antibody: Rabbit anti-Tyrosine Hydroxylase recombinant monoclonal antibody. Secondary: HRP-conjugated goat anti-rabbit IgG. Substrate: DAB.

benchmarkantibodies.com/wp-content/uploads/2024/03/9009_2.jpg

Detection of human Tyrosine Hydroxylase in FFPE SK-N-BE(2) cells by immunocytochemistry. Antibody: Rabbit anti-Tyrosine Hydroxylase recombinant monoclonal antibody. Secondary: HRP-conjugated goat anti-rabbit IgG. Substrate: DAB.

benchmarkantibodies.com/wp-content/uploads/2024/03/9009_3.jpg

Detection of human Tyrosine Hydroxylase by Western blot. Samples: Whole cell lysate (10 µg) from HEK293T, SK-N-SH, SK-N-BE(2), Jurkat, and SK-N-MC cells prepared using NETN lysis buffer. Antibody: Rabbit anti-Tyrosine Hydroxylase recombinant monoclonal antibody used at 1:1000. Secondary: HRP-conjugated goat anti-rabbit IgG. Detection: Chemiluminescence with an exposure time of 30 seconds. Lower Panel: Rabbit anti-COPB2 antibody.

benchmarkantibodies.com/wp-content/uploads/2024/03/9009_4.jpg

Detection of human Tyrosine Hydroxylase in FFPE mouse olfactory bulb by immunohistochemistry. Antibody: Rabbit anti-Tyrosine Hydroxylase recombinant monoclonal antibody. Secondary: HRP-conjugated goat anti-rabbit IgG. Substrate: DAB.

benchmarkantibodies.com/wp-content/uploads/2024/03/9009_5.jpg

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009 react with?

This antibody reacts with human, mouse, and rat samples.

For which applications has the rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009 been validated?

The antibody is suitable for Western blot (WB) and immunocytochemistry/immunofluorescence (ICC/IF) applications.

How should the rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009 be stored to maintain stability?

Store the antibody at 2-8°C for short term use and at -20°C for longer term storage, avoiding freeze/thaw cycles.

What is the concentration and form of the rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009 provided?

The antibody is supplied as a liquid at a concentration of 1 mg/mL.

What immunogen was used to generate the rabbit anti-Tyrosine Hydroxylase monoclonal antibody 9009?

The immunogen is full-length human Tyrosine Hydroxylase expressed in and purified from E. coli.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.