rabbit anti-thioredoxin (TRX1) polyclonal antibody 1004

Price range: $121.00 through $2,600.00

Antibody summary

Rabbit polyclonal to Thioredoxin (Trx1)
Suitable for: IP,WB
Reacts with: Hu
Isotype: IgG
100 µL, 10 µL

available sizes

Clear

SKU: 1004parent Categories: antibody, oxidative stress Tag: Trx1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	polyclonal
concentration	1 mg/mL
applications	IP, WB
reactivity	polyclonal, rabbit, TRX1
available sizes	10 µL, 100 µL

rabbit anti-TRX1 polyclonal antibody 1004

antibody
Database link: human P10599 mouse P10639 rat P11232
Tested applications WB,IP
Recommended dilutions WB: 1:2000-10000, IP 2 - 10 µg/mg lysate
Size and concentration 100µL and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer Tris-citrate/phosphate buffer, pH 7 to 8 containing 0.09% Sodium Azide
Purity affinity purified
Clonality polyclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens TXN Thioredoxin
Protein names Thioredoxin
Alternative names ATL-derived factor, Surface-associated sulphydryl protein
Gene names TXN
Protein family Belongs to the thioredoxin family
Function Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions (PubMed:17182577, PubMed:19032234, PubMed:2176490). Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity (PubMed:16408020, PubMed:17606900). Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity (PubMed:11118054, PubMed:9108029)
Subcellular location Nucleus, Cytoplasm, Secreted
Structure Homodimer; disulfide-linked (PubMed:17260951, PubMed:9369469). Interacts with TXNIP through the redox-active site (PubMed:17260951). Interacts with MAP3K5 and CASP3 (PubMed:15246877). In case of infection, interacts with S.typhimurium protein slrP (PubMed:19690162). Interacts with APEX1; the interaction stimulates the FOS/JUN AP-1 DNA-binding activity in a redox-dependent manner (PubMed:9108029)
Post-translational modification In the fully reduced protein, both Cys-69 and Cys-73 are nitrosylated in response to nitric oxide (NO). When two disulfide bonds are present in the protein, only Cys-73 is nitrosylated. Cys-73 can serve as donor for nitrosylation of target proteins In case of infection, ubiquitinated by S.typhimurium protein slrP, leading to its degradation
Keywords 3D-structure, Acetylation, Activator, Allergen, Alternative splicing, Cytoplasm, Direct protein sequencing, Disulfide bond, Electron transport, Nucleus, Proteomics identification, Redox-active center, Reference proteome, S-nitrosylation, Secreted, Transcription, Transcription regulation, Transport, Ubl conjugation
Sequence MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
UniProt accession: P10599

Data

WB-image-anti-Thioredoxin (Trx) antibody-1004_2

Detection of human Thioredoxin Reductase 1 by western blot. Samples: Whole cell lysate (50 µg) from HeLa, HEK293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Thioredoxin Reductase 1 antibody #1004 used for WB at 0.1 µg/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Thioredoxin (TRX1) polyclonal antibody 1004 react with?

This antibody reacts with human Thioredoxin (TRX1).

For which experimental applications is this antibody validated?

The antibody is suitable for immunoprecipitation (IP) and western blotting (WB) applications.

What are the recommended dilution ranges for western blot and immunoprecipitation using this antibody?

For western blotting, the recommended dilution is 1:2000 to 1:10000. For immunoprecipitation, 2 to 10 µg of antibody per mg of lysate is suggested.

How should the rabbit anti-TRX1 polyclonal antibody 1004 be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C while avoiding repeated freeze/thaw cycles.

What is the concentration and form of the rabbit anti-Thioredoxin antibody provided?

The antibody is supplied as a liquid at a concentration of 1 mg/mL, available in sizes of 10 µL and 100 µL.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.